ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_002840 ()

zinc finger (C3HC4 type) / FHA domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_18423

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL13P1.405 conserved protein, unknown function
  • PBANKA_135730 conserved Plasmodium protein, unknown function
  • PY06836 ERYTHROCYTE MEMBRANE PROTEIN PFEMP3
  • PVX_083110 hypothetical protein, conserved
  • PCHAS_136190 conserved Plasmodium protein, unknown function
  • PKH_121010 hypothetical protein, conserved
  • TGME49_002840 zinc finger (C3HC4 type) / FHA domain-containing protein
  • NCLIV_022070 zinc finger (C3HC4 type) / FHA domain-containing protein, putative
  • cgd8_4800 SSM4 like ring finger with a forkhead associated (FHA) domain (apicomplexan-specific architecture)
  • Chro.80552 erythrocyte membrane protein PFEMP3
  • CMU_011250 zinc finger C3HC4/FHA domain-containing protein
  • TP01_0478 FHA domain protein, putative
  • TA20645 FHA domain protein, putative
  • BBOV_I003650 FHA domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_002840 zinc finger (C3HC4 type) / FHA domain-containing protein
MHDELRLRVECTTWHRDSHDLFDYETRHVNVKQFVVTRSARLFRLDADINCVLESAPVPGPPALAQSAAASNSATPEARD
GAAPGAQGACGAQSGDHRDSAPATGGASADRDQNGGQEERGSGASGTSAGVTQGESQSANAASAANAQTVPAAAGVVAAA
SSTSSPPLLSTDFLLSIKCVKDGKFVIVPADRSLCGSAATTLVPKKLWSIVREQNNNKHILQEGDVIKLGRFKLRVKQLV
TKKKSEDNAMGEESATGDDDSAPELRLEDGEPPVSRAAPEDMQCRICLLEGNQEGDPLISPCECKGSIKFVHVQCLRHWI
NGRLNLNEQQQRSAFFFKQIHCELCKVPYPTAVKYEKEDGQTTERMQVVSVPRTEPPFIILENMVGVQQKGVHVISMASK
KDLKLGRGHESDVRIPDVSISRYHATIRFVDGHFQLEDHNSKFGTLVCLRKAFPVGDVDVALQVGRSVVKFSLDEAPVTA
PAIADVSNEIQRQQSPIPEPSSFPAEQSSSSAPVSGSGSSGPSSSQVAGAHASLSSRLPPHHVLASLLSADIRQHQASLS
SHPRGANFSSFSDFQLPPHLASAPPGVAAAAAALAAATAVANRGAPVSSRASMGPAPSTALGSTAPVGNAAAADAAVAAA
AAAAAAARFEEAMAAAAAAAAAANQVAGTRGGPSNAGSPHGSQGVEGGLEGLQTSLASEGVATTAGGSGRVGNASYGDGS
VPPFLGLPHARSANSSSGSVASPSGSSNAFAHASASAQQLFALHQQLQQLQQAQQLQQAQQAQQAQMSSSSPAASALCSR
SLPGTVSSSQQVPLHLALAAVLQQQQEAAAAATRVYEGLGAPASGGAYGHATPAPLSQSQLAGTVSAPNSSPRTAQPRAT
SPHGFVRQGSFFSGSSNHTPRSGPGGASGTHSYPPMVLSSASPSAVNGFHVSPRGTTHANLGAAHGAGTPPHAHAFASSQ
SGVTPAAVQGGGPAGSSGVGPGSGPLCMQQGLSYPEEVGSAHAGGPNARVSSDGSATSGGVWLGGNCRTSL

Gene-Specific Links for TGME49_002840

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins