ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_002680 ()

mitochondrial-processing peptidase alpha subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11390

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFE1155c mitochondrial processing peptidase alpha subunit, putative
  • PBANKA_123790 mitochondrial processing peptidase alpha subunit, putative
  • PY00244 mitochondrial processing peptidase alpha subunit homolog
  • PVX_080095 mitochondrial processing peptidase alpha subunit, putative
  • PCHAS_123830 mitochondrial processing peptidase alpha subunit, putative
  • PKH_100910 mitochondrial processing peptidase alpha subunit, putative
  • TGME49_002680 mitochondrial-processing peptidase alpha subunit, putative
  • NCLIV_022220 hypothetical protein
  • cgd7_2080 mitochondrial processing peptidase, insulinase like metalloprotease
  • Chro.70239 mitochondrial processing peptidase alpha subunit
  • CMU_034120 peptidase M16 inactive domain-containing protein
  • TP02_0218 ubiquinol-cytochrome C reductase complex core protein II, mitochondrial precursor, putative
  • TA11975 mitochondrial processing peptidase alpha subunit, putative
  • BBOV_III003850 mitochondrial processing peptidase alpha subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_002680 mitochondrial-processing peptidase alpha subunit, putative
MNASILFRRNAPGVSTCLRRRCLRPAALAAASASGVSTPASGVWTPAFQRTEKRFLSGAALQPKAGPAPEYRRVPFVKED
MEKVMEEVPEFKYYYVGKENTKGNVYEGIPLDQSILEPADLRDYVPPHSNIQYSKLDNGLRIASMDRGGLTASLGLFVHA
GTRFEDVTNFGVTHMIQNLAFASTAHLSLLRTVKTIEVLGANAGCVVGREHLVYSAECLRSHMPLLVPMLTGNVLFPRFL
PWELKACKEKLIMARKRLEHMPDQMVSELLHTTAWHNNTLGHKLHCTERSLGHYNPDVIRHYMLQHFSPENMVFVGVNVN
HDELCTWLMRAFVDYNAIPPSKRTVASPVYTGGDVRLETPSPHAHMAIAFETPGGWNGGDLVAYSVLQTILGGGGAFSTG
GPGKGMYTRLYLNVLNQNEWVESAMAFNTQYTDSGIFGLYMLADPTKSANAVKVMAEQFGKMVSVTKEELQRAKNSLKSS
IFMNLECRGIVMEDVGRQLLMSNRVISPQEFCTAIDAVTEADIKRVVDAMYKKPPTVVAYGDVSTVPHYEEVRAALRAAG
VGK

Gene-Specific Links for TGME49_002680

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins