ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_002570 ()

ribophorin I, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12817

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • TGME49_002570 ribophorin I, putative
  • NCLIV_022370 Ribophorin I, related
  • cgd6_5070 ribophorin I -like, putative dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67kDa subunit precursor, signal peptide plus transmembrane domain at C-terminus
  • Chro.60585 ribophorin i
  • CMU_021530 ribophorin I family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_002570 ribophorin I, putative
MEYEAYLFANIAGVVALLLIFFFHWVADQRPAGSREREETCRFTAGEASQVSKLGRKSGQETRQRSTGVELQPLLPIPWK
PSVSRSICLASLLRPSLCGGCFLSVFSHFRASRLRSFFEIPMSRYDAAIGGRLILKGKGLPSNEKKKKKKRKRDDDDDAC
EVKREKVERFGEEQEDKRYKERNAEAEETCEERYPVGDEEVDEDLLLLEEEQNPNWTPAEKAFRLAQKKREKDRVNERLK
LTHRQRMEKLNIHLASLSERFASHRAGAWVQGIRWREKGKATGAAPDVANAVVATASDPSDEALEIALSMPTLCSRQPRG
STPVLFVVFFLLLLFWLFSLLLRLASPWPLSCPLGALLLAEAKDFRFDSLEIAHRSPDLHHPLPYPVDASACGLAALRRL
GERLRESTKQTSSRHTWRRGEETSEILEKAMKTGVVIEKLERRLDMKRQVKVTIRTTVANHGASAVENLAFLLPFHEAVQ
VGWMAAKQNGQTVSFDAISERPRISSFSPHTPASLSHDALLFEEVDQALQVAAGVAADSPSGGRSGANDLARSTREEGED
ECRPLLLELHLRKPLEPQGRTHIEITYILGRAYRPVPRAAPLGAVQSVLFVSTSAWPSPYPVLHGSSTAVALAPGTSLGP
AGATRIMKKYGFKQESQPDGPWMIVAPGPTLPFEVGQPFVLHMPLPLHLGYFLSAERFVEVSHFGNIFFHEWYRLHNDAA
KLEGSYDAITAAALQGIQPGAPRFSRHMKKDEVNDPREPPASHMLTHLVAALPKRAFSLEVFDQIGNVSSTRAARVGPEA
QPIYTELELYPRFPLLGGWNTDFQVQYNLPARTVMVKHADAHRYTLNLTLAPPFRDIYTEDVFLNIALPSGAQNVTVTSP
RKVDWNVNEKLHSWLDVFTFRPLLKLHFPSSFVPDRNILQFKVQVSYDYPPFLAVEVFKQLQICLLVFVLFLLLILSRRL
RVSIACPREKEKQETEETAMSVMRHLLEVFEEISQSSDDLIEGMHRLRASASSREQNSGDGLSQWKARMARASETLEKHL
ELLDKEQQAQFFPGLRASFQVYRHHVEGLATCLKDLEDSGERAKTMSGRFEGIPAVDRGSAVKALDFVGNHGVGVGQSAG
IQF

Gene-Specific Links for TGME49_002570

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins