ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_002540 ()

3',5'-cyclic nucleotide phosphodiesterase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13542

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • MAL13P1.118 3',5'-cyclic nucleotide phosphodiesterase, putative
  • PBANKA_141980 3',5'-cyclic nucleotide phosphodiesterase, putative
  • PY03988 cGMP phosphodiesterase A4, putative
  • PVX_122885 3',5'-cyclic-nucleotide phosphodiesterase, putative
  • PCHAS_142160 3',5'-cyclic nucleotide phosphodiesterase, putative
  • PKH_142050 cAMP-specific 3',5'-cyclic phosphodiesterase 4D, putative
  • TGME49_002540 3',5'-cyclic nucleotide phosphodiesterase, putative
  • NCLIV_022390 hypothetical protein
  • BBOV_IV006510 3'5'-cyclic nucleotide phosphodiesterase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_002540 3',5'-cyclic nucleotide phosphodiesterase, putative
MRLREHSLLLCVDAMSRDSPVASPAHSGVFGPSADAKVSEVFSLPSLSAIPRAASASSLSRENSLVSSRRASPSVSPPAG
SPLWRLVRRCGQGEGERENVERCRLRERREECGAARRGPPASAATSDCSCPSAGDRRRVQSRRRRARTFQGRSFCGNHVS
TEAEREGETEGEEETEGEEGREEYDSKRRGRLARRLGRRFVIAAAERGRKREGEETIVLRGNQGECWQEAQRTADSPDCS
SSSVCCFGGSCSTASQCCACMRLASVSCLSPSSSFSTFHCSLPAVSSASAAFVCPREPPGSDSNSSPSCASSRGFSPSSP
KATVSSSRPSSSSASPLRSSLSAPSGLFPVGSGCSSDVCVSVPLPALFRGCRVHSSAPSSRTEQGTALLTGAPPSANELE
AASAMANPTNSSRFSRVKTVSFATLSECGSSHISRRSDSASEPEAEREKPGLCSMRVARRESSPAARSPGRQSERRGTDS
SCTSLPQRSDRAGRDRVGSRGSAEQRSSTSSRRVSDHSRAEAGLWSAGPGDSGASLEPDLESRSAFLRRCRARLAAARRK
VCQAFQSLAEHDLVFRMKEDLAQMRHESSLRSVFADACRERSGVEMSERTRLSVGGGTGRHLSVGTSTHKEGSTHKEGSE
KERIRDGGSASPSTHLSRSGSGDVILRRFPLKFVDRGLEDLFADNINRWMATRLLLMGVLSLVVTSVMWPLMAWSFNLLD
AFNHSEPLGILFHINMAVTVFVAVLFIVTKRCRHLAEHAELIADGGTFLVVTIWGIWNTTASYILEHSYVQDVIGSAYPM
HPADAPISLEKTSAWSTSLEASSAVAYLYGLLLIVQLDVVYPSRTRRTWQVHLMFFGFSTASIVIRGALNPDFVPVPFVV
IRALTYLMLTVFLFIGRHATELQQRHTFYNWLTTRKRMDRLESDLKRQREKVKVSTAVEQLVHMVKHCMESCQTVESEVG
SELHVSYRSLLIDCHQTLSRCLSILTHTSDLYTVQFGDLDSDAHRDIIQAFLNNHNSSPADWTRVTTAAYTRGVEDGCWS
ASDASSEAKSGDLGTPFAGSEALALVRRDSSHSWASSRGASAWPLQANWTGTLDGVHVHAFLHAVPEACGGAATPEHDGL
RGEGLGDLGRASPRRQAGRQLTRLDEGRERDSEPEDLTDDGDSAEPPKNAASETEEKVSVPDNGRKTPTQALGEMKPGLT
SKGLHDTLARVRASTHREVESRGRERRGDSAPCSSPSQRLTPQSLADFQARLRYEALIKLVNASPRTPELSLGIPVSEEA
ARDWNFDCLRHAQLSPTPLVDVGYALLHRTSEDMRLPPDVVLRFLTAVEIQYNHVPYHNCIHGLMVAQKMVALTEVLELS
QSIGSRDRALVVVAGLCHDIGHPGRNNALFINALDPVAVLYNDKSVLENYHSCLTFKTLELPDCDIFFSLRTKDYHMVRS
LIIDLILATDMKNHFETVSRFRVRRNALDFDLSSEEDFWFAVKIIMKCADLSHCSVPWSQHFQWCQRLSVEFYDQGDEEV
ARHLPMSPLCDREKHSEVAKSQLGFMSFVAVPLFEELMAIDGTGNIEKYCISVMKTNASHWEALSSAAVPVPLLGEAPSP
DVAPPLLHLIDGSGAAAVHPGSKAAEIANRYASSTVTTLDLTCLVYRTQLNRARRSSQQSGRRVSEGTSA

Gene-Specific Links for TGME49_002540

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins