ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_001840 (ASP1)

eukaryotic aspartyl protease, putative, a gene from Toxoplasma gondii

Compiled localisation
apical and not dense granule and not microneme and not rhoptry during after assembly of tachyzoite daughter cells and after tachyzoite cell division and non-dividing tachyzoite
inner membrane complex during tachyzoite cell division

Who localised this protein by microscopy?

Shea, M., Jakle, U., Liu, Q., Berry, C., Joiner, K. A., Soldati-Favre, D.
A family of aspartic proteases and a novel, dynamic and cell-cycle-dependent protease localization in the secretory pathway of Toxoplasma gondii. (2007 Aug, Traffic) PubMed / full text
   more detail about this publication

apical and not dense granule and not microneme and not rhoptry during after assembly of tachyzoite daughter cells and after tachyzoite cell division and non-dividing tachyzoite, inner membrane complex during tachyzoite cell division

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10470

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_001840 eukaryotic aspartyl protease, putative
MSPSSRFRNLVSVDSSSQDFGKRSSLYASLLDSASVSSLPGICSAAEDRDVEDESWKDPSSSSHCAKTEGGACAFPRLNQ
VLSSLRDPMGVFSRAKRRRSLGKAVGLSTSVICVVALFGIVCLCLYGLVNFSFTSVETSPLDDPRNSPVMGELGNPQAST
PSSARADTPARHDRQNQMFSPWSVQNEQFLGEDSDALPHAGPLFRSGVMVMPLRKMKSLRQIGWDKNTITVPDLQAHLVA
ALRMQEGLSKKDDGNLSGLSNGDDISIHDYMNSQYYTEIYVGSPGQKVRVVVDTGSSDLWVCSASCGILCMMHKTYNHGK
SDTYHADGTPYHVQYASGPVGGFLSADDVALASLKTKNFLLAEAVDLKGLGTAFFFGKFDGILGMGFPSLATKGLKPFMQ
AAVEQNVVKNWVFAFYLASANGVDGELAIGGVDQERFIGDINFSPVVDSRYWMINTKGLKSDGDLIAPTTKMIIDSGTSL
IVGPLDEVKRIATMMGAFSVPLMPEGMFFISCEKAKVLRDLQLEIEGQDYPIKIKDLLISASAAAGTPCLFGMMGLKALE
GGRPTPQKNGFGIFPPSQLVASAKGPIGRTWILGDLFMRNVYTVFDYDNKQIGFARLKN

Gene-Specific Links for TGME49_001840

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins