ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_001780 (MIC2, MIC 2)

microneme protein 2, a gene from Toxoplasma gondii

Compiled localisation
microneme during bradyzoite and extracellular tachyzoite and intracellular tachyzoite and tachyzoite
nowhere except microneme during intracellular tachyzoite
parasite plasma membrane during extracellular tachyzoite
during not intracellular tachyzoite

Who localised this protein by microscopy?

Rooney, P. J., Ayong, L., Tobin, C. M., Moreno, S. N., Knoll, L. J.
TgVTC2 is involved in polyphosphate accumulation in Toxoplasma gondii. (2011 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite

Laliberte, J., Carruthers, V. B.
Toxoplasma gondii toxolysin 4 is an extensively processed putative metalloproteinase secreted from micronemes. (2011 May, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during extracellular tachyzoite and intracellular tachyzoite
  • "Next, to determine the subcellular localization of TLN4, we examined intracellular and extracellular tachyzoites by immunofluorescence microscopy. TLN4 localized to the apical periphery of the parasite, which substantially overlapped with the well-characterized microneme protein TgMIC2 [23] in both intracellular and extracellular parasites (Fig. 3A-C, upper panels)."
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during intracellular tachyzoite and extracellular tachyzoite
  • Other genes localised in this publication: peptidase M16 domain containing protein

Kawase, O., Nishikawa, Y., Bannai, H., Igarashi, M., Matsuo, T., Xuan, X.
Characterization of a novel thrombospondin-related protein in Toxoplasma gondii. (2010 Jun, Parasitol Int) PubMed / full text
   more detail about this publication

microneme and parasite plasma membrane during extracellular tachyzoite, during not intracellular tachyzoite
  • "Additionally, IEM analysis demonstrated that TgSPATR was localized in the slightly dense structures of the parasite apical end, which must be micronemes because they were clearly distinguished from rhoptries and looked quite similar to micronemes shown in previous reports (Fig. 2f) [9,12]."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme and surface during extracellular tachyzoite, not during intracellular tachyzoite
  • Other genes localised in this publication: hypothetical protein

Gordon, J. L., Beatty, W. L., Sibley, L. D.
A novel actin-related protein is associated with daughter cell formation in Toxoplasma gondii. (2008 Sep, Eukaryot Cell) PubMed / full text
   more detail about this publication

microneme

Brossier, F., Jewett, T. J., Sibley, L. D., Urban, S.
A spatially localized rhomboid protease cleaves cell surface adhesins essential for invasion by Toxoplasma. (2005 Mar 15, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite
  • "(A) TgROM1 (HA9) was localized at the apical part of intracellular (Upper) and extracellular parasites (Lower) where it colocalized with MIC2 in micronemes."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during intracellular tachyzoite and intracellular tachyzoite
  • Other genes localised in this publication: rhomboid family domain-containing protein, rhomboid-like protease 4, rhomboid-like protease 5

Brossier, F., Jewett, T. J., Lovett, J. L., Sibley, L. D.
C-terminal processing of the toxoplasma protein MIC2 is essential for invasion into host cells. (2003 Feb 21, J Biol Chem) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite
  • "MIC2-TAG and mutant forms of MIC2 were correctly localized to micronemes."
  • Microscopy type: Light
  • Microscopy method: myc tag, monoclonal antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during intracellular tachyzoite
  • Other genes localised in this publication: SRS29B (= SAG1, P30), MIC2-associated protein M2AP

Miller, S. A., Binder, E. M., Blackman, M. J., Carruthers, V. B., Kim, K.
A conserved subtilisin-like protein TgSUB1 in microneme organelles of Toxoplasma gondii. (2001 Nov 30, J Biol Chem) PubMed / full text
   more detail about this publication

microneme during extracellular tachyzoite
  • "Co-localization with MIC2 confirmed the identity of these organelles as micronemes. "
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during extracellular tachyzoite
  • Other genes localised in this publication: subtilase family serine protease, putative

Donahue, C. G., Carruthers, V. B., Gilk, S. D., Ward, G. E.
The Toxoplasma homolog of Plasmodium apical membrane antigen-1 (AMA-1) is a microneme protein secreted in response to elevated intracellular calcium levels. (2000 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme
  • "To localize TgAMA-1 in T. gondii, dual label immunofluorescence microscopy was performed on free tachyzoites using MAb B3.90 and antibodies against known microneme (MIC2), rhoptry (ROP1), or dense granule (GRA8) antigens."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: micronemes
  • Other genes localised in this publication: apical membrane antigen 1, putative, dense granule protein GRA8, rhoptry protein, putative

Kaasch, A. J., Joiner, K. A.
Targeting and subcellular localization of Toxoplasma gondii catalase. Identification of peroxisomes in an apicomplexan parasite. (2000 Jan 14, J Biol Chem) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite
  • "Catalase (green channel) does not colocalize with various parasite organelles by IFA. Micronemes (a), rhoptries (c), and dense granules (e) (all in the red channel) are labeled with monoclonal mouse antibodies to organellar proteins."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during intracellular tachyzoite
  • Other genes localised in this publication: peroxisomal catalase, Rhoptry kinase family protein ROP2A (incomplete catalytic triad), dense granule protein 3

Carruthers, V. B., Sibley, L. D.
Mobilization of intracellular calcium stimulates microneme discharge in Toxoplasma gondii. (1999 Jan, Mol Microbiol) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite
  • "MIC2 is observed within intracellular micronemes, on the extreme apical tip (arrow) and along the side of the extended tip (arrowhead)."
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: 2F
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during intracellular tachyzoite
  • Other genes localised in this publication: -

Wan, K. L., Carruthers, V. B., Sibley, L. D., Ajioka, J. W.
Molecular characterisation of an expressed sequence tag locus of Toxoplasma gondii encoding the micronemal protein MIC2. (1997 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme and nowhere except microneme during intracellular tachyzoite
  • "Affinity purified anti-rc50 antisera specifically reacted with a single protein of identical molecular mass as MIC2 and exclusively labeled the micronemes of T. gondii by cryo-immunoelectron microscopy. These results demonstrate that c50 encodes for MIC2, a previously characterised microneme protein of T. gondii."
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AAB63303, annotation matches
  • Localisation record: microneme and nowhere except microneme during intracellular tachyzoite
  • Comment: essential? Cannot be disrupted
  • Other genes localised in this publication: -

Achbarou, A., Mercereau-Puijalon, O., Autheman, J. M., Fortier, B., Camus, D., Dubremetz, J. F.
Characterization of microneme proteins of Toxoplasma gondii. (1991 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during bradyzoite and tachyzoite
  • "In all cases, apical labeling of tachyzoites and bradyzoites was observed by indirect immunofluorescence assay. Immunogold localization on ultrathin sections of bradyzoites or tachyzoites showed a specific labeling of micronemes. The following proteins were characterized using 2-dimensional gel electrophoresis and Western immunoblotting: Mic 1 (60 kDa, Pi 6.5), Mic 2 (120 kDa, Pi 5) and Mic 3 (90 kDa, Pi 6.75)"
  • Microscopy type: EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during tachyzoite and bradyzoite
  • Comment: fulltext not available online
  • Comment: strain information not found
  • Other genes localised in this publication: microneme protein MIC1, microneme protein MIC3

Orthology

OrthoMCL

Part of OrthoMCL group OG4_20693

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFC0640w CSP and TRAP-related protein
  • PCHAS_041380 circumsporozoite- and TRAP-related protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_001780 microneme protein 2
MCVLVPEGVEDVIQSESAIGAAEGCTNQLDICFLIDSSGSIGIQNFRLVKQFLHTFLMVLPIGPEEVNNAVVTYSTDVHL
QWDLQSPNAVDKQLAAHAVLDMPYKKGSTNTSDGLKACKQILFTGSRPGREHVPKLVIGMTDGESDSDFRTVRAAKEIRE
LGGIVTVLAVGHYVKHSECRSMCGCSGTSDDDSPCPLYLRADWGQLATAIKPMLKEVCKTLPQDAICSDWSAWSPCSVSC
GDGSQIRTRTEVSAPQPGTPTCPDCPAPMGRTCVEQGGLEEIRECSAGVCAVDAGCGVWGEWSAWSASCGNATRKRERTR
YNDPPPQGAGRRCENQDPPVLQEQTEEATLAPCITIPPTPPEWAAWSDCTVTCGGGNRHRVRNALPPGLGSQNGESDESL
VSKLWPGTDLRQEEACNTSPCPINATCGQFEEWSTCSVSCGGGLKTRSRNPWNEDQQHGGLSCEQQHPGGRTETITCNPQ
ACPVDERPGEWAEWGECSVTCGDGVRERRRGKSLVEAKFGGRTIDQQNEALPEDLKIKNVEYEPCSYPACGASCTYVWSD
WNKCVCPMGYQARHAAVKFDYRNKPCDLPTFETKACSCGETNPVPSEGTTPGAPGATGPEQPNQRPLPEGSDENETPTNE
EGEQSKKESGSGIAGAIAGGVIGGLILLGAAGGASYHYYLSSSVGSPSAEIEYEADDGATKVVMEEEKETLVPVDDDSDM
WME

Gene-Specific Links for TGME49_001780

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins