ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_001710 ()

U3 small nucleolar ribonucleoprotein complex-associated protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11563

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFL1290w conserved protein, unknown function
  • PBANKA_144150 conserved Plasmodium protein, unknown function
  • PY06717 similar to U3 snoRNP-associated 55-kDa protein
  • PVX_123965 WD domain, G-beta repeat domain containing protein
  • PCHAS_144350 conserved Plasmodium protein, unknown function
  • PKH_144350 hypothetical protein, conserved in Apicomplexan species
  • TGME49_001710 U3 small nucleolar ribonucleoprotein complex-associated protein, putative
  • NCLIV_023030 WD-40 repeat protein, related
  • cgd3_1090 Rrp9p/U3-55K-family snoRNP-associated protein with several WD40 repeats
  • CMU_042770 hypothetical protein, conserved
  • TA09145 hypothetical protein
  • BBOV_III003230 WD domain, G-beta repeat domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_001710 U3 small nucleolar ribonucleoprotein complex-associated protein, putative
MAARGSGRPRGGSRGRRKEEAGQKRKRLIPRKRQTAETEPALRKRAKKDEDEEILSDDADGPSFSGDEELASVDGDDNGE
SAQDAEVEGEFADERRLRIAQQFLSQLAARTGKRRKDDEQEEDDEEEDEEEDTEMDRLLRKAAPTRSGTAFAPIASSLSL
SPAPLAFLRGHKRPLTCVAAPGVGDASEATPEPLSSGAAPSASPLDRHIYTGGKDCCVILWDLQEEKKTIFEGARNDARA
GGHFRPVLDVCVAPDERFFCSVGEDELVRIWDARTSTKKCVASLRGHSGPIRSVKFNSFPSSAAAAVARGERSAFSSAGD
IELVTCSADKSVKLWNLTLRACLNSFYGHTAPVSRLDVIQPNKPLTVGEDNCARSWKLIQDSHLVFSPQLSSLESCALLT
PSLFACGSASGVVSLYSSTFKRPLGARFASQNSETTAEKRAAGGREVGVTAMAAMRRTDAFFSGTEDGRIQLWKARAKEA
GKSRDEGDSENGPSSPLALLSSSSVGPAGGVVADLTLSPSYGFLVAGISKESRCGRWIVNKSARNGIAIYKIQQM

Gene-Specific Links for TGME49_001710

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins