ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_001680 ()

eukaryotic translation initiation factor 3 subunit 10, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12144

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFL0625c eukaryotic translation initiation factor 3 subunit 10, putative
  • PBANKA_142870 eukaryotic translation initiation factor 3 subunit 10, putative
  • PY04546 eukaryotic translation initiation factor 3 subunit 10
  • PVX_123340 eukaryotic translation initiation factor 3 subunit 10, putative
  • PCHAS_143050 eukaryotic translation initiation factor 3 subunit 10, putative
  • PKH_143000 eukaryotic translation initiation factor 3 subunit 10, putative
  • TGME49_001680 eukaryotic translation initiation factor 3 subunit 10, putative
  • NCLIV_023050 eukaryotic translation initiation factor 3 subunit 10, putative
  • cgd5_390 putative eukaryotic translation initiation factor 3
  • Chro.50354 hypothetical protein
  • CMU_041540 hypothetical protein, conserved
  • TP01_0235 eukaryotic translation initiation factor 3 subunit 10, putative
  • TA19545 eukaryotic translation initiation factor 3 subunit 10, putative
  • BBOV_IV005090 translation initiation factor 3 subunit 10, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_001680 eukaryotic translation initiation factor 3 subunit 10, putative
MQSFQKPENALKRADELLSVGQQDAALKILHGAIGHRRFRSQGWDSVQETIMIRHVQLCVDENKLRLARDGLHQYRIISQ
HANIQSLGKVIAELRSRAEQKLTQAKESAAGASASPKSADAPVLPGQGLGDLDSVADSPEDLLLSTLQIEVRSAEARGIH
QALRSVWDVYKMVLDLLRTTPKLERVYHETARKAFLFCKENQRPQEFKRLCDVLRSHFALILKNRHKEDYESLMRPDLHL
ETRMQQLVVASELELWRECYATAEDLYSLGLHDYFLKALRTGQDLFHNSREKLMRWLAIYYEKLSRVTWVAENYLFHALA
WIKLLLHVKGFKKNASQEDLQAMASVAVLAVLSIPISGAEKKPGDDAVTMGEGMNYGSLEQQKKLTMLLGHSTLPSREGL
KAVLFTKDLVSLADENCQQLLSLIESEFTPLKLCSLCQPLLDAVSANPLLEPYVYPLKRVIFHKLIFQLSRVYATLSIKH
FTTHICTASFLPWSHAEKLFVALVQEQQASSSSFGSASANSNANLSIRLDYASSAILFETPDAAAANTLRHQLCNLAKQI
DKAVHMICPGQSMEERMDRRRFLQELPARLEAETRRMAERTRATHSRRLEKQEEQQKMEEERRRKEAEQRRVEEKQERER
REEATRRREERRMQQEKIKQRSETAAQMLEEIKKLGTKASSNILIKGKQLGDINIDDVLQGNVDYDDLEKAQMMQLNQER
IARLRQRRQNFRRVCHFIRACREEELPLLIRWQEEQLARDTQILLDMQNRHEEEHKAAFEAALEEKQIFEVVKEDKEKWV
AEKIAVRQKDFEQQAQEQRERLLHVLRQAKIQRARARKEEHLKKLKIEVERKRMEEEQKKYLEQLEKKRQEEEAKAKRLA
EQAEKQRQRELEIEEKQRQLDLEASAALRSAPRAAPASPQKVEGSISPASSVPPSAGDSWRKGDRTETARRRVPAQSQGR
GEQDEGFERWREGKVNSGNGNDEEKTRPRFRVAAAALSEHLSAGKEGRDEIQNGDAQKPEDDGFTTVSRNRRK

Gene-Specific Links for TGME49_001680

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins