ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_000320 (HXGPRT-I, HXGPRT-II) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

hypoxanthine-xanthine-guanine phosphoribosyl transferase, a gene from Toxoplasma gondii

Compiled localisation
cytosol during tachyzoite
inner membrane complex during daughter tachyzoite and mother tachyzoite and tachyzoite

Who localised this protein by microscopy?

Chaudhary, K., Donald, R. G., Nishi, M., Carter, D., Ullman, B., Roos, D. S.
Differential localization of alternatively spliced hypoxanthine-xanthine-guanine phosphoribosyltransferase isoforms in Toxoplasma gondii. (2005 Jun 10, J Biol Chem) PubMed / full text
   more detail about this publication

cytosol during tachyzoite, inner membrane complex during daughter tachyzoite and mother tachyzoite and tachyzoite
  • "Immunoblot analysis of fractionated cell extracts and fluorescence microscopy indicated that HXGPRT-I (which lacks the 49-amino acid insertion) is found in the cytosol, whereas HXGPRT-II (which contains the insertion) localizes to the inner membrane complex (IMC) of the parasite."
  • Microscopy type: Light
  • Microscopy method: epitope tag
  • Strain: RH
  • Gene model mapping comments: annotation matches, gene model inconsistent, sequence doesn't match figure 1
  • Localisation record: cytosol during tachyzoite
  • Other genes localised in this publication: membrane skeletal protein IMC1
  • "Immunoblot analysis of fractionated cell extracts and fluorescence microscopy indicated that HXGPRT-I (which lacks the 49-amino acid insertion) is found in the cytosol, whereas HXGPRT-II (which contains the insertion) localizes to the inner membrane complex (IMC) of the parasite."
  • Microscopy type: Light
  • Microscopy method: epitope tag
  • Strain: RH
  • Gene model mapping comments: annotation matches, sequence matches figure 1
  • Localisation record: IMC during tachyzoite, pellicle during mother tachyzoite and daughter tachyzoite
  • Other genes localised in this publication: membrane skeletal protein IMC1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10843

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_121080 hypoxanthine phosphoribosyltransferase, putative
  • PVX_094840 hypoxanthine phosphoribosyltransferase, putative
  • PCHAS_121150 hypoxanthine phosphoribosyltransferase, putative
  • PKH_081190 hypoxanthine phosphoribosyltransferase, putative
  • NCLIV_038170 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8), related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_000320 hypoxanthine-xanthine-guanine phosphoribosyl transferase
MASKPIEESRSQKRSAFSDIFCCCTPNEGAIVPSDPMVSTSAPARTSAPARSSALQDYGKGKGRIEPMYIPDNTFYNADD
FLVPPHCKPYIDKILLPGGLVKDRVEKLAYDIHRTYFGEELHIICILKGSRGFFNLLIDYLATIQKYSGRESSVPPFFEH
YVRLKSYQNDNSTGQLTVLSDDLSIFRDKHVLIVEDIVDTGFTLTEFGERLKAVGPKSMRIATLVEKRTDRSNSLKGDFV
GFSIEDVWIVGCCYDFNEMFRDFDHVAVLSDAARKKFEK

Gene-Specific Links for TGME49_000320

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins