ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_000290 (ROM1) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

rhomboid family domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
golgi apparatus during intracellular tachyzoite and tachyzoite
microneme during extracellular tachyzoite and intracellular tachyzoite and tachyzoite
endoplasmic reticulum and post golgi compartment and rhoptry during intracellular tachyzoite

Who localised this protein by microscopy?

Brossier, F., Starnes, G. L., Beatty, W. L., Sibley, L. D.
Microneme rhomboid protease TgROM1 is required for efficient intracellular growth of Toxoplasma gondii. (2008 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

golgi apparatus and microneme during tachyzoite
  • "TgROM1 localized to the Golgi apparatus and micronemes"
  • Microscopy type: Light, EM
  • Microscopy method: HA9 tag
  • Strain: tTa
  • Gene model mapping comments: Blast from AAT84608
  • Localisation record: golgi and micronemes during tachyzoite
  • Other genes localised in this publication: -

Sheiner, L., Dowse, T. J., Soldati-Favre, D.
Identification of trafficking determinants for polytopic rhomboid proteases in Toxoplasma gondii. (2008 May, Traffic) PubMed / full text
   more detail about this publication

endoplasmic reticulum and golgi apparatus and post golgi compartment and rhoptry during intracellular tachyzoite
  • "In transiently transfected parasites, R1NtR5 NtTy localized to the ER, Golgi and also to the apical organelle, rhoptries (Figure S2A), residents of which were shown to posses sorting signals directing anterograde trafficking from the Golgi."
  • Microscopy type: Light
  • Microscopy method: Ty tag
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: ER and golgi and rhoptries and post golgi compartment during intracellular tachyzoite
  • Other genes localised in this publication: rhomboid-like protease 4, rhomboid-like protease TgROM2, microneme protein MIC4

Brossier, F., Jewett, T. J., Sibley, L. D., Urban, S.
A spatially localized rhomboid protease cleaves cell surface adhesins essential for invasion by Toxoplasma. (2005 Mar 15, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

microneme during extracellular tachyzoite and intracellular tachyzoite
  • "(A) TgROM1 (aHA9) was localized at the apical part of intracellular (Upper) and extracellular parasites (Lower) where it colocalized with MIC2 in micronemes."
  • Microscopy type: Light
  • Microscopy method: HA tag
  • Strain: RH hxgprt-
  • Gene model mapping comments: Blast from AY587210, gene model inconsistent
  • Localisation record: microneme during intracellular tachyzoite and extracellular tachyzoite
  • Other genes localised in this publication: rhomboid-like protease 4, rhomboid-like protease 5, microneme protein 2

Dowse, T. J., Pascall, J. C., Brown, K. D., Soldati, D.
Apicomplexan rhomboids have a potential role in microneme protein cleavage during host cell invasion. (2005 Jun, Int J Parasitol) PubMed / full text
   more detail about this publication

microneme during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_18207

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_000290 rhomboid family domain-containing protein
MARVRTLADLRTEDEADEHTPLYNAETGSRDSDSTSSGGAAPRSMPIRFLELLFPHFSLRSVVLAISIVDWIFYIVTVCL
DTELPLIPAANILVHFGANYPPLIKQGQVWRLLLPVFLHANFFHVFFNVFFQLRMGFTIERRYGLLKFTGLYFASAIYGN
LLSATAFFCNSLKVGASTAGFGLIGIQICEMALTWHRMRHRDRMLTNMVSFVLLMVLLMFTLNGGSIDQMGHLGGLLCGF
SIGMLYNKELNDKPVWYPWASAAAIGILLALPAACFPILYAVDRHCHRDLSYI

Gene-Specific Links for TGME49_000290

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins