ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_000250 ()

PAN domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
apical during extracellular tachyzoite and tachyzoite
microneme and rhoptry during extracellular tachyzoite

Who localised this protein by microscopy?

Chen, Z., Harb, O. S., Roos, D. S.
In silico identification of specialized secretory-organelle proteins in apicomplexan parasites and in vivo validation in Toxoplasma gondii. (2008, PLoS One) PubMed / full text
   more detail about this publication

apical during tachyzoite

Zhou, X. W., Kafsack, B. F., Cole, R. N., Beckett, P., Shen, R. F., Carruthers, V. B.
The opportunistic pathogen Toxoplasma gondii deploys a diverse legion of invasion and survival proteins. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

apical and microneme and rhoptry during extracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_26842

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_000250 PAN domain-containing protein
MDALKTVFNRRIALPVVVAAALLHNSAEALQSPGLRRQLVNSHSFAEVETTGYSCFEKGKEYVGFSLTEFAKVGDAALCQ
QRCNQHPQCGFFTFYSNENRCVLQSRKPSQENNNANAVSGPKRCPLCLVDNYDFRGETNMHKSGAPGLNTLLACQQGCAA
EPKCKAFLFEKRPRTCHFKTSDNYLKSFHPDTSYIAGPKTCTDEHWCIMKDIGYKGTDSKATKANSAAECQQMCLNDERC
DFFTWQQAGKHCWFKAGASTASTKYNRAGDYSAPKHCGLPTTCVKERTKYAGETVATFPKSEVGTFESCQMKCWKTSKCV
FMHFNNDGCTLSGINATAQTDANSKAGDITC

Gene-Specific Links for TGME49_000250

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins