ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_000240 ()

PAN domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
microneme and rhoptry during tachyzoite

Who localised this protein by microscopy?

Chen, Z., Harb, O. S., Roos, D. S.
In silico identification of specialized secretory-organelle proteins in apicomplexan parasites and in vivo validation in Toxoplasma gondii. (2008, PLoS One) PubMed / full text
   more detail about this publication

microneme and rhoptry during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_26842

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_000240 PAN domain-containing protein
METVTTLFNRKIALSFVVAAALLHNSAEALQSPGLRRQLVNVHSFAEVETTGYSCLEKDKEYVGFSLTEFTEVGDAGLCQ
QRCNQHPHCSFFTFYSNGNRCVLQSRKPSQEKNNADAVSGPKRCPLCLVDSFDFRGEANLHHKGAPGLNTLLACQQGCAA
EPRCKGFLFEKRPRTCHFKTNDNYLKALDPDTSYIAGPKTCTDEHWCIMKDIGYRGTDSKETRANSAAECQQMCLNDERC
DFFTWQQAGKYCWFKAGASTASTKYNRAGDYSAPKHCGLPTTCVKERTKYAGETVATFPKSEVGTFESCQMKCWKTSKCV
FMHFNNDGCTLSGINATAQTDANSKAGDITC

Gene-Specific Links for TGME49_000240

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins