ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TA14920 (HSP70, mthsp70)

heat shock protein HSP70 homologue, putative, a gene from Theileria annulata

Compiled localisation
cytosol and host cell cytosol and mitochondrion during schizont

Who localised this protein by microscopy?

Schnittger, L., Shayan, P., Biermann, R., Mehlhorn, H., Gerdes, J., Ahmed, J. S.
Molecular genetic characterization and subcellular localization of Theileria annulata mitochondrial heat-shock protein 70. (2000 Jun, Parasitol Res) PubMed / full text
   more detail about this publication

cytosol and host cell cytosol and mitochondrion during schizont
  • "Immunoelectron microscopy showed that the hsp70 protein was predominantly localized in the mitochondria of the parasites"
  • Microscopy type: light, EM
  • Microscopy method: polylonal antibody
  • Strain:
  • Gene model mapping comments: blast from AY271268, annotation matches
  • Localisation record: mitochondria and cytosol and host cell cytosol during schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10225

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TA14920 heat shock protein HSP70 homologue, putative
MKSLSRLYSIFHSSRCSLELSNKLSTISGITTMLDSLRIGSRRGIFTTSGRFAKVQGDVVGIDLGTTNSCVAIMEGSTPK
VIENAEGARTTPSIVAFTDDGQRLVGVVAKRQAVTNPENTVFATKRFIGRKFDDPETKKEQSTLPYKIVRSSNNDAWIEA
QNKQYSPSQIGAYILAKMKETAESYLGRTVSKAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAFGMDKND
GKTIAVYDLGGGTFDVSILEILGGVFEVKATNGNTSLGGEDFDQRILNYLVEEFKKSNGIDLKKDKLALQRLRESSESAK
IELSTKTQTEINLPFITADQSGPKHLLIKLSRSKLEQLTSELLEGTVDPCKKCLKDAGVNASELNDVILVGGMTRMPKVT
EVVKNIFGKEPSKAVNPDEAVAMGAAIQAGVLKGEIKDLLLLDVCPLSLGIETLGGVFTRLINRNTTIPTKKSQIFSTAA
DNQTQVGIKVYQGERGMAADNQLLGQFDLVGIPPAPRGVPQIEVTFDVDANGIMNISAVDKSTGKRQEITIQSSGGLSEE
EVEKMVKEASNYKEQDERRKELVDVRNESESLLYSVEKQLTDLKDKVSSSELDQLRTLSTSLKEVLSSDDVSAIKDKHKQ
LQELSWKVSQAAYSKSNTGATSANTSENTNTSNEENDTHNK

Proteomics

Found in:

Not found in:

Gene-Specific Links for TA14920

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins