ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TA03350 ()

chaperonin CPN60, putative, a gene from Theileria annulata

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_18450

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_144680 chaperonin CPN60, mitochondrial precursor, putative
  • PY04757 chaperonin cpn60, mitochondrial precursor
  • PY04792 chaperonin cpn60, mitochondrial precursor
  • PVX_100550 chaperonin CPN60, mitochondrial precursor, putative
  • PCHAS_144900 chaperonin CPN60, mitochondrial precursor, putative
  • PKH_144920 chaperonin cpn60, mitochondrial
  • TGME49_040600 TCP-1/cpn60 chaperonin family protein, putative
  • NCLIV_016800 TCP-1/cpn60 chaperonin family protein, putative
  • TA03350 chaperonin CPN60, putative
  • BBOV_IV007010 chaperonin cpn60, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TA03350 chaperonin CPN60, putative
MLCRMKFFLFFYFLNSIYSISTLGVFYRHSEILIPKLSNYSFAPFKLFQNKNNRAFSFINNAPNSFSNSTKLAELVDSAK
SSQALNYRKNHNVYSKAKEIVLSDECRNSLLNGILQVADTVRVTLGPRGRNILLEKEFGTPIIVNDGVTIARNIELSDRK
MNAGAKLIQEIASSSDDRAGDGTTSTAILAAEIASKGVQYVNEGHNSIPLQKGIQKAGKLIIEEIKKLSKPVSGYNDLLN
VATVATSGNVVMGQVIAKAFDKLGGNAAVVLEDNPALEDELDFTEGYTFDRGFANPYFLLGEEKESIEWTNPQILVYDGK
IENAQSILNILEYAAKNKLNLLIIAEDYGTDAMQTFIINKMRGMLKIVAVKAPSFGERRKDYLQDIAVATGATFVSSDVG
VDLNDITPAMLGNAKNVVIKKDRTSIVTNTEVLPQIKTRINNLIREKEMCTSNFDKTKLSERIAALSGGIARIRIGAATE
TELKEKRLRYEDAINAVRAAMETGYVPGGGVTYLQMQNQDFTNKLMDYIKNTVDKEQSELTPVETTSDEGNTSVPPGVDG
QKVVERILKSGKPFGYGWNAKTNTYGDMIKQGVIDPSKVIMSAVEHSTSVAGLLLTTEGMMVEKQENKTTDDETPTNNF

Proteomics

Found in:

Not found in:

Gene-Specific Links for TA03350

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins