ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY06858 ()

V-type H(+)-translocating pyrophosphatase, a gene from Plasmodium yoelii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12221

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_132050 V-type H( )-translocating pyrophosphatase, putative
  • PBANKA_144980 inorganic pyrophosphatase, putative
  • PY00513 vacuolar-type H+ pumping pyrophosphatase-related
  • PY06858 V-type H(+)-translocating pyrophosphatase
  • PVX_100710 vacuolar-type H+ pumping pyrophosphatase, putative
  • PVX_117625 V-type H(+)-translocating pyrophosphatase, putative
  • PCHAS_132380 V-type H( )-translocating pyrophosphatase, putative
  • PCHAS_145210 inorganic pyrophosphatase, putative
  • PKH_124930 V-type H( )-translocating pyrophosphatase, putative
  • PKH_145370 vacuolar-type H -translocating inorganic pyrophosphatase, putative
  • NCLIV_064810 hypothetical protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PY06858 V-type H(+)-translocating pyrophosphatase
MKELYCIIFGPPVLGLLFSVIECISISRIHIGASDDKLDKVENGQAKIEKMKEIASYISEGANSFLSKEYQYLIVFMILF
SGLLSWFINYYTAISFAIGCITSIICGYIGMKIAVYANVRTTSETWKSLDKGFKVTLNAGTVMGFSLVSLSIISLGALIF
AYKAQFQFSDDPALYKAIAGFGLGGSSIALFSRVGGGIYTKAADVGADLSGKNEYGIPEDDIRNPACIADNVGDNVGDMA
GMGADLFGSLAESLCASLVIGSSVLSLPENMKSFDINYCFMFPLFFSSASIISSMLTFFLVTKIVRVTGKEGVERTLKYL
LFISTIFQSLTIFVVGQYCLPPVLVYDVLKQIPNWKIIVPALVGLWSGLIIGFTTEFYTSYSFRPVQEIANTQKISAATG
IIYGLSLGYKSTFIPIICLSGALGISYVFCEVYGVALAAVGMLSTLCICLTIDAYGPISDNAGGIAEMAGLPSEVREKTD
ILDAAGNTTAAIGKGFAIGSAALVAFALFGAYASSAKVRHVNILNPWVIIGLLIGSMLPYLFSALTMKSVAIAANSVLNE
CLEQFPLILANKQKPDYDKCIKISTDASLRQMILPGLISVTFPLIIGMLMGKYATAGLLIGIILSGIQLAFSSTNSGGAW
DNAKKYIESGALGTDHCKGSNAHKNSVIGDTVGDPLKDTSGPSINILIKLSAITSLVFAGLISNHFTSKTGGPIWL

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY06858

General Sub-Cellular Localisation Links