ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY06415 (pAg-2)

merozoite surface protein precursor, a gene from Plasmodium yoelii

Compiled localisation
plasma membrane during trophozoite
merozoite surface during merozoite

Who localised this protein by microscopy?

Burns, J. M. Jr, Belk, C. C., Dunn, P. D.
A protective glycosylphosphatidylinositol-anchored membrane protein of Plasmodium yoelii trophozoites and merozoites contains two epidermal growth factor-like domains. (2000 Nov, Infect Immun) PubMed / full text
   more detail about this publication

plasma membrane during trophozoite, merozoite surface during merozoite
  • "By immunofluorescence, pypAg-2 expression was localized to both the trophozoite and merozoite membranes."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody to whole protein
  • Strain: 17XL
  • Gene model mapping comments: blast from AY005132, inconsistent gene model?
  • Localisation record: trophozoite membrane during trophozoite, merozoite membrane during merozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48031

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PY06415 merozoite surface protein precursor
VLIRKERKRKSKSDFSKGEPENKEHEIINLYDDVQELLGPDEMNMLDKYSILGIDDCSNENENNKIISEYDLKAMKSVLL
YKNRISRASINNLDDVKTVFKRCFNKDDPELSKSYEQIQNQVANEGTTIIDYLSNYISNIYIKINDEFVKNEEFQLSKYI
PELEIINYVLYNGPKEIGNKIKNELIEINNLIISESLTSIYSSVVSGLNINCKIKDDLITILNLANGKYFKVNFSSQATM
IIPEQYSHESEHMKKISEYFIEKNRVCKNENCPINSNCYVIDSVETCRCIPGFSKNEESENLECLINESTSCENNNGGCD
VNANCILLEDKIMCECNNKFNGDGIYCSSAIYYGMNVFIFFLISIVCIYIM

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY06415

General Sub-Cellular Localisation Links