ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY05977 (MAEBL)

erythrocyte binding protein, a gene from Plasmodium yoelii

Compiled localisation
rhoptry during early schizont and late schizont
not parasite plasma membrane during early schizont
merozoite surface during late schizont

Who localised this protein by microscopy?

Noe, A. R., Adams, J. H.
Plasmodium yoelii YM MAEBL protein is coexpressed and colocalizes with rhoptry proteins. (1998 Oct 30, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during early schizont and late schizont, not parasite plasma membrane during early schizont, merozoite surface during late schizont
  • "MAEBL colocalizes with rhoptry proteins … At this early stage of schizont development MAEBL localized only to intracellular punctate bodies near the schizont surface (Fig. 4(B)), structures likely representing developing rhoptries. The mAb to MSP-1 reacted to late-stage segmenting schizonts in a pattern characterized as ‘clusters of grapes’ where rings of fluorescence were apparent around the merozoite plasma membranes (Fig. 4(E)). MAEBL also became evenly distributed around the merozoite plasma membrane as schizonts matured (Fig. 4(F)) colocalizing with MSP-1 (Fig. 4(H)). MAEBL was also seen in the rhoptries of these parasites as a double dot of fluorescence at the apical end of formed merozoites."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to homologue
  • Strain: YM
  • Gene model mapping comments: blast from homologue PF11_0486
  • Localisation record: Rhoptry and not PM during immature schizont, rhoptry and merozoite surface during mature schizont
  • Other genes localised in this publication: merozoite surface protein 1 precursor, apical membrane antigen-1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11812

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PY05977 erythrocyte binding protein
MKIYHNIFGFCIFISLWTPSIRAIDNPQEDFMDRFDILNNHVNIKWTNSGSLGQGNLKFDIYDEDNISSKLNSLENARLC
PNNEKGNIYRGSCPDYGKTFSMDLDKDEYSEDFLNEISLGLLNKKLLIDVEIPVNMSGLAMYQGLFANCPYDKNHVNDIK
NEKEYDMCFDKFYSNKQNISTRIKKYPLISKYTYFGSHGLGGRLGSNTEYPLHIYNPIENYRTQKMRYPKLVETLEDCSI
YSHCIGPCFDRDFDNKCFRDLPVAFNHKTKECIIIGTHEEKKTTNCNSDNSRNNGRCFSSIKKEKGKDWTYASSFLRPDY
ETKCPPRYPLNNSEFGYFNYNTGNCESPTKLYDNSVISFNECIEKLFNFNYANEDPEEKRNNYLWGVWVLGNKQNKLNSM
NDLGVCALLKEKPTCVLKKQNYYSFTNLTANYFDNNQNIEYPDIENVKIWKNRNSELSDNLKYNDKKFKNSDINKGMAIN
MNDINEIKENSKLQTNKGNETKKTKYGLYNYPITPISYLQIHHKMELKNYNMDSENSFTSFHNTNAPTHYEGNSKFSTGV
NNKRENTYGTQDINLNRNNNYNQPKNKPNPQAEYMDRFDIEKNHIYIDWKQDGKYGSGKLKYNIISHETADTIQSLLITD
KDDICPNHYSPGRAQGSCPNYGKSIVVKTPESINGNEHLNSNFLNEIRTGYLNKYMKSNVELPYEKSGLAMHHGDLSVCP
KSWDEENLYKKNRDYNYDMCKSTVMKSTIPLKMFDYKTKKLLYFGLYGLGGRLGSNISKVKNIFKSQPNNITLPMFNPSS
IKNLLDCSLYSYCLGPCLENAYNNKCFRSLPAYFNHETNECIILGTHEQERNNNCRTRRSDTDKPNCQNVRKNISTKNWT
YVTSFIRPDYEEKCPPRYPLKFKSFGKYDEETGKCKSLINKKNIINIPLFSSCLEYMFIMYPSVLQRTEKKNYWGVWVAS
ESVNSSNLYNAKGECYYINEKPNCVIDKVNHFSFTSLTTNDIDFNQNINLVKLDELVINNDQSSSHNRAKYNTPIENSES
TIVRKHNSAPEHFRSLKINSYTPNRRGENFAKESDSTRNTDESKMDEVIRKREEAAKNAEIIRKFEEAQKAAWAKKAEEE
RKKAEAVKKAEEERKRIEAEKKAEEERKRIEAEKKAEEERKRIEAEKKAEEERKIIEAAKKAEEERKRIEEAKKAEEERK
KIEAAKKAEEERKKAEAVKKAEEAKKKAEAAKKAEERKKKAEAAKKALERKKKAEAAKKALERKKKAEAAKKAEEKKKAE
AAKKAEEEKKKAEAAKKAEEEKKKAEAAKKAEEEKKKAEAAKKAEEEKKKAEAAKKAEEEKKKAEAAKKAEEEKKKAEAA
KKAEEERKKAEAAKKAEEERKRIEAEKKAEEERKKAEAAKKAEEERKRIEAEKKAEEERKRIEAEKKAEEERKRIEAEKK
AEEERKRIEAVKKAEEERKRIEAEKKAEEERKRIEAVKKAEEERKRIEAEKKAEEERKIIEAAKKAEEERIKAEAVKKEE
EVIKKNSNLSETKISNNYETRNIDDNSFKKLDEEEYKSRNIDNTRNKIISMSKENMCTNDVSSKYCDYMKDKISSGNCSN
DERKQLCCSISDYCLNYFDYNSNKYYDCTKKEFSDPLYKCFSNEEYSKAVYFAGAGIIMSILIAICLKIIGKKWFKEVAF
DEIVEDYDKVYTLAMISSEKL

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY05977

General Sub-Cellular Localisation Links