ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY05748 (MSP-1, MSP1)

merozoite surface protein 1 precursor, a gene from Plasmodium yoelii

Compiled localisation
surface during early schizont and late schizont
during schizont

Who localised this protein by microscopy?

Pei, Y., Tarun, A. S., Vaughan, A. M., Herman, R. W., Soliman, J. M., Erickson-Wayman, A., Kappe, S. H.
Plasmodium pyruvate dehydrogenase activity is only essential for the parasite's progression from liver infection to blood infection. (2010 Jan 5, Mol Microbiol) PubMed / full text
   more detail about this publication

during schizont

Noe, A. R., Adams, J. H.
Plasmodium yoelii YM MAEBL protein is coexpressed and colocalizes with rhoptry proteins. (1998 Oct 30, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

surface during early schizont and late schizont
  • "The MSP-1 is a GPI-anchored merozoite surface protein expressed early in schizogony on to the plasma membrane of merozoites [15]. Surface expression of MSP-1 was seen at the two to four nuclei stage in immature schizonts (Fig. 4(A)); which is consistent with previous findings [16, 17]. … The mAb to MSP-1 reacted to late-stage segmenting schizonts in a pattern characterized as ‘clusters of grapes’ where rings of fluorescence were apparent around the merozoite plasma membranes (Fig. 4(E))."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain: YM
  • Gene model mapping comments: Blast from homologue PFI1475w, annotation matches
  • Localisation record: surface during immature schizont and mature schizont
  • Other genes localised in this publication: erythrocyte binding protein, apical membrane antigen-1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_37556

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PY05748 merozoite surface protein 1 precursor
MKVIGLLFSFVFFAIKCKSETIEVYNDLIQKLEKLESLSVDGLELFQKSQVIINATQPTETIDPFTNHNFAQQVQDFVTK
FEGLGFTEQTELVNLIKALTPNRYGVKYLIESKEEFNGLMHAINFYYDVLRDKLNDMCANNYCEIPEHLKISEEETEMLK
KVILGYRKPIENIQDDIEKLEIYIERNKETVAALNALIAEETKKIQPEGNEDCNDASCDSDKYNKKKPIYQAMYNVIFYK
KQLAEIQKVVEVLEKRVSTLKKNDAIKPLWQQIEVLNAAPVVTAETQIVTGGQSSTEPGSGGSSASGTSSSGQASAGTGV
EQANTVASVTVTPSVGQNGEASTNPQTAQVQPVPTLTLEEKQKKIAGLYAQIKEIAKTIKFNLEGIFVDPIELEYFKKEK
KKESCNLSTSSCKKNKASETIIPLTIRYPNGISYPLPENDVYNKIANNAAETTYGDLTHPDNTPLTGDLATNEQARKDLI
KAIKKKIKAEEKKLETLKTNYDNKLTEFNQQKTPFKEAAKEFYESKFRNKLTSEIFEKFKTKRDEYMTKKTELNTCEYGN
TKELINKLNKQLNYLQDYSLRKDIISNEIEYFSNKKKELQYNINRLAEAVQAKQNVLVASKDVPLSTLVELQIQKSLLTK
QIEQLNKTEVSLNKAQLKDKLYVPKTYGNEGKPEPYYLIAVKKEVDRLAQFIPKIESMIAKEKERMEQGPAITGESEEVP
SGPSAESSTDRSTQSSTSSSSSSSSTPAAAESSSATLPEAPAPAEAASPSTEASEETTIPPTTQETQPSQAASSTTPAKP
VMTKLYYLEKLQKFLVFSYSCHKYVLLQNSTINKDALSKYALTSEEDKIRTLKRCSELDVLLAIQNNMPTMYSLYESIVD
GLQNIYTELYEKEMMYHIYKLKDENPSIKSLLVKAGVIEPEPVAAPTPVTPAATEQQQQQATPDVQSDAPAPSDVSQQPE
TPVTSTTPEVTTSTEASSSAPGEGTPSGEAGASGTEGATASNAATPAGTSASGSAASNASTTSDVTPPAAAAAVPSTSTP
APAQPPAANSQSGNPDSGIRSRAESEEDMPADDFELDNLYKSYLQQIDGNNTEFINFIKSKKELIKALTPEKVNQLYLEI
AHLKELSEHYYDRYSTYKLKLERLYNKHEQIQLTNRQIRDLSILKARLLKRKQTLNGVFYILNGYVNFFNKRREAEKQYV
DNALKNTDMLLKYYKARTKYFTSEAVPLKTLSKASLDRESNYLKIEKFRAYSRLELRLKKNINLGKERISYVSGGLHHVF
EEFKELIKDKDYTGKKNPDNAPEVTNAFEQYKELLPKGVTVSTPAVAVTTTLAADAPATPEGAVPGAVPGAVPGAVPGAV
PGAVPGSGTDTRVAGSSVDDNEDDDIYQIASGQSEDAPEKDILSEFTNESLYVYTKRLGSTYKSLKKHMLREFSTIKEDM
TNGLNNKSQKRNDFLEVLSHELDLFKDLSTNKYVIRNPYQLLDNDKKDKQIVNLKYATKGINEDIETTTDGIKFFNKMVE
LYNTQLAAVKEQIATIEAETNDTNKEEKKKYIPILEDLKGLYETVIGQAEEYSEELQNRLDNYKNEKAEFEILTKNLEKY
IQIDEKLDEFVEHAENNKHIASIALNNLNKSGLVGEGESKKILAKMLNMDGMDLLGVDPKHVCVDTRDIPKNAGCFRDDN
GTEEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTPNAYYEGVFCSSSSFMGLSI
LLIITLIVFNIF

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY05748

General Sub-Cellular Localisation Links