ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY05634 ()

ubiquinol-cytochrome c reductase, iron-sulfur subunit, putative, a gene from Plasmodium yoelii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11036

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF14_0373 ubiquinol-cytochrome c reductase iron-sulfur subunit, putative
  • PBANKA_130330 ubiquinol-cytochrome c reductase, iron-sulfur subunit, putative
  • PY05634 ubiquinol-cytochrome c reductase, iron-sulfur subunit, putative
  • PVX_118520 ubiquinol cytochrome c oxidoreductase, putative
  • PCHAS_130650 ubiquinol-cytochrome c reductase, iron-sulfur subunit, putative
  • PKH_126690 ubiquinol cytochrome c oxidoreductase, putative
  • TGME49_120220 ubiquinol-cytochrome c reductase domain-containing protein
  • NCLIV_010020 Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 1.10.2.2), related
  • TA10085 ubiquinol-cytochrome c reductase, putative
  • BBOV_III009930 ubiquinol cytochrome c oxidoreductase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PY05634 ubiquinol-cytochrome c reductase, iron-sulfur subunit, putative
MIRIRNIALISKNNIFLRKNELNKISQRYFGGTFNHNIKENERVPPASENPGYKNLFDHAEDIKLWEIEEKENITHKKVD
DLSELVEPSNHPHQYEGIFVRTRYAHYNQTAEPVFPRKPDLEKGELASGANVTRTDVWHNPNEPAIVSVGKFEPNNFRPA
GYIENAPNPDSINSDYHPDFREYRLRSGNADRRTFMYFISASYFFIMSSIMRSTICKAVHFFWISKDLVAEGTTELDMRT
VGEGEQVVIKWRGKPIFVKHRTPEDIQRAREDDKLVETMRDPQLDSDRTIRPEWLVNIGVCTHLGCIPAPGGNYNGYFCP
CHGSHYDNSGRIRQGPAPANLEVPPYEFVDENTIKIG

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY05634

General Sub-Cellular Localisation Links