ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY04926 ()

hypothetical protein, a gene from Plasmodium yoelii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11313

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PY04926 hypothetical protein
MLNTLLNIASSYSSSECKEKTILNNKVCFKETYNKEEEDNRKKSANNYNINNICESKVQANNNENNNNNNNSSTIPNSIK
SNLASNVNYNNMQNGQFEKSSNSTKCMGYNFQAKEVNNTIGNDSSNSNNNYDDNTNKNEALNKFEKKENDTIMNMSLSGK
NGVVDFEKGSDNNNSSNDNATINSNRSNNIGDLKKSEHVNNSQGNHNNFIKNNDSVNNSTFKIQDTSNISNVNETLPIIT
VNNDNNNNNCSSNSEIISEMGYSQDTVKNPSSVANPSHIFSKSCNDYNKIEISDEKCDHVNNNNSHITQESKITQISENT
KINDSTVHGKISNCASSNNNAAENDDSNKNDSNKNDSNKSDNNKSDNNKSDNKNSYGNSSGNNNNNNKGGSGNRPGNNNN
TGNSNGGGNGTDPDGNDNKDDNNEKDKDKNNSSNDNNNNNNNNDKIKKKENNNKNGDSNVKKTNKNVNGNDNIETKKSNT
KSLISNTNSSSTISGSSLNADAPEFVPSTKSVQGNLQFNNLMWGNYYHDISNNSFGNMQNVNLLNMNGLGNNNNIMIQTP
LIDNMTNINNDTTGSNLLGIQNSSNNNSSTIIDSNLNGYNNKTGGIVGSNSVVNKNNTNAGNTNTPLGAQFNGVDGNEKF
TDKNNNNHLTSISGNNSKVNNNNNNNNIHGINTEDNSNNNTTGLGNKNLGGTGPIDSTYLNHNMLEGGKNLRSNNFMNNS
ENSNGFDNSDIHSTSNNNSNNNNAHQNFPGNNSMMHHHPHHHNFYLNPPYLINNHPNGLSSHQTIFTPIPYGGGGVAGTN
NGDIHHDLPFPQPPVYNHFGNNSINVQKNANLNMNPYNFISCGLPGAGPLATGGPINMASHHHIDPHFLNSADNVPMKLP
YNHMGQTNRRNNMFNHFGNNVNLHGPNNINENNYDINSNNNNMNPLISANIGGAGYVFNSAYNTMQPGVMRINTDGSTST
NSNNTSNNANNNTNNNSGNNNSPSNGNNNNNGSLNTTGNVIGLNPSIINPGVNVPIPHHHIDNINNPMHINGIHMNHGLL
LNNPNINNIHNIGNHVPMGNVGNMGNGMVGLVGVGSIGGMNATGNISKQQKRQNVYNDRTGGMNNNNTENVGTNNNNNTT
SGSTNNKQYNNNYKENKNTMKNNMGNGNEVLNNYNYGMKHENNKKNNSRYNLINNTTDNFNTNYNYNGSNTMKNNSATSK
GSYNNKGGKEESNNITGGNNFYNRNGVNTSTTGGGGSITSTIGNTTNNVNTSNDNTKEAGVSGDATKEVVSDLNESNNTK
TNNNKENFQYGNYKGKNNYYLNSSNDKNSKGHSNTIANQNVVTTSNNKEDYKSGRNYGSNKIVDDKSGTNTSKKDAGKDN
TNNNNNNNSGRYGKQGDNWVKKGYGANNSNTSNNINSRTNNSTTKHGSYSNSKYNTGSDRRGSNTRYDEGGNKTEKLGYK
TNDKKGKPEEDKHTKENKINSSNNAEINNNQTNEAGNKNSNTNPSNEENNTTGYNANNKVGYNNIKNVKNGDKKNMEFSS
WVKIAKMNPNNKKKNEKINVSTPQPDNTNPAPSSSSSVKNGNTGDTNHNYSNSRNYNKGAGYGKGFHGEVPQINEENETP
LLSTNKESKKNAEIKEDAKKESHLLSSTTNTNQRYDSNNKGVKKSGGADDKIKGKTIGNYSGNKNYINEEARNKDSNRQK
GVDNK

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY04926

General Sub-Cellular Localisation Links