ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY04858 (CTRP)

ookinete protein-related, a gene from Plasmodium yoelii

Compiled localisation
apical during ookinete

Who localised this protein by microscopy?

Kaneko, O., Templeton, T. J., Iriko, H., Tachibana, M., Otsuki, H., Takeo, S., Sattabongkot, J., Torii, M., Tsuboi, T.
The Plasmodium vivax homolog of the ookinete adhesive micronemal protein, CTRP. (2006 Sep, Parasitol Int) PubMed / full text
   more detail about this publication

apical during ookinete

Orthology

OrthoMCL

Part of OrthoMCL group OG4_20693

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFC0640w CSP and TRAP-related protein
  • PCHAS_041380 circumsporozoite- and TRAP-related protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PY04858 ookinete protein-related
MNKKFVLALSYLVLCVHFIIASTKGNQDEFDGGKDVRDSFLEKSISKRQSPPCVGDECFCQSYYDLTLILDESGSIKKKH
WVKYVVPFTEQIVKGLKVGENDIHVGILLFALKNRDYITFDNDIRYKKTELLKKVNDLNDDYRSGSDTYILEALKYSMNK
YSMSKNARDDAPKVTILFTDGNDRHASKSEFHKMYSEYQEKHIKLLVLGVSAAEEKKLKVIAGCEEHSSCPSAMKAEWET
INNITNKLTNKICDTESESNIIPEPEPEPEPETSQPIPCIGDDCFCKDYYDLTLILDDSGSITLNKWEKDVIPFSEKLIN
NLNIGKDNVHVGIMRFSKDIVIDVDYSQDTRYIKNELANIVEGLSKKYRYGSRTDIVDALDYSLKNFTRHPNSRTDAPKV
TILFTDGNDTSKTLAEERNMGILYRSEQIRLILVGVGQASSIDLYALADCDHGKHCPQVIECKWNDLTGITSVITDKICD
IESGENSNPSETPESSGVTNPTETPESSGVTNPTETPESSGVTNPTETPESSGVTNPTETPESSGVTNPTETPESSGVTN
PTETPESSGVTNPTNPDNVVSCQNDEDCYCKDFYDVTLILDESASIGESRWVLEVIPFAKDIINHLNIDYDSVHVGVLLF
SHYALDLVPFSDEARYNKISLLKKIDSLKTNYGNGYESFIVKTLKYALYNYIKDSGRSNAPKITMLFTDGNDSSESDMDM
YNIGSLYRTERVKLLVIGVSMASENKLKQLVGCAQNVPCPFVIKTEWGTLDALSKVFVDKICDTGSILPPESNKPETEVP
TPQCIGNDCFCHDIYDLTVILDESGSIGSYNWKNQVYPFTEQFINNLEISEDKVHVGIMLFAQFNRDFVMFSDKESYDKE
HMMKLIKGLKDSYKSGGYTYIIEALNYGLENYTHHKDSRSDVPKVTMLFTDGNNTNPGDKLLSDASLLYKEENVKLLVVG
VGASTMANLRLLAGCHKTDGDCPLATKTEWNNLQDISKLMADKICNAETPEIEEPESTCLGDECICGDYFDLTLITVPIT
TLDYNHRTGFTRYARNIINMFNIGKKNIHASISMYLGVRSVNIDFDDDLTHDKKGLLMALDQMNHYFAEEETNITEALEI
GLKQIFGKGNREKAPKIALLLTDSNNDAYEKSKLENISKEYTDKGVKLLVMGRVELSKEILFVAGGCDINNDTCPNVLIY
NSFINDNTAEKFLEENICDNSNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGNGN
GNGNGTGNGNGNGTGNGNGNGTGNGNGNGTGNGTGNGTGNGTGNGTGNGTGNGNGNGNGNGTGNGNGNGNGNGTGSGNGN
GNGTGNGTGNGNGNGTDNGNGTGNGNGNGTGNGNGNGTGNGTGNGNGNGNGTDNGNGNGTGNGNGNGTGNGTGNGNGNGN
GNGNGTDNGNGNGTGNGNGNGTGNGNGNGTGNGTGNGNGNGTGNGTGNGNGNGTDNGNGTGNGNGNGTGNGNGTGNGNGT
DNGNGNGTGNGNGTGNGNGNGTGNGNGTDNGNGNGNGTGNGNGNGNGNGNGTGNGNGNGNGNGTGNGNGNGNGNGNGTGN
GNGTGNGNGNGNGNGNGNGNGNGNGNGVGNGTDNGNGNGSGESGGSPLPPSIQCDDEFCEECDDDVCDNNPTCKKAMDIV
IALDQSRGITNLQWTTYVKPFMVHTVKENYLSQNRSHVTIVKMRANKGKEQWGLYRKLSYKKNRILNKIDKLQMSYSNII
NLADNLKYIRTKTFKRTPAHKKKLIVMLVEGKSNTDLNELRREIELLKLNKITLYVYAIDNIDEKEYKILGDCEGPSSIC
ENIVKVSWENLLSSVEIHNKFICNKYPEDAECSEWGEWSPCPQLSCDSAVSRRERKKPYYTLKEEGYSGTEYGDSCMDLG
SIEYRSCPVKDECNDICGDFGEWSQCSTSCGDGIRMRTRNASPDNSMCQTFNKTEIEPCNIQSCGSTEICEDIGDWSEWS
SCSKTCGYSIRERKFTIFPESIDEHSYCEHFEKIETEVCSVPKCENEECFDWEDWSEWSAPCGPRKRVQRARLHKNKSGN
PSTIPSPNNGQNDKCEDFYQDKIEYDEESSCPDNTCGSWSEWSECDRPCNAGMRIRNFITNIVSLNGENDDECLETYNKI
ENEPCLDLPVCNSGECNDWETWVDCKTDKDSYSCHMPNKRILTRKLDLLKNPKSDTAEACNDYSLFREEDCPIGNTPCVD
ALCNEWDEWGSCSETCGLDSFRIRKRKEPLELIPASSDIDGNIGLTCEEQNVRIEEKEACNVPACVPPVLDGSNTNTGED
GEGGSSGEGFGTGEKISMAAGIIGLVGLAAGGLIYGYNTLNGGETPHNSNMEFENVENNDGIIEEENEDFEVIDANDPMW
N

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY04858

General Sub-Cellular Localisation Links