ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY04285 (1-Cys Prx)

1-cys peroxidoxin, a gene from Plasmodium yoelii

Compiled localisation
cytoplasm during schizont and trophozoite
during not ookinete and not sporozoite and not zygote

Who localised this protein by microscopy?

Muller, S.
Redox and antioxidant systems of the malaria parasite Plasmodium falciparum. (2004 Sep, Mol Microbiol) PubMed / full text
   more detail about this publication

cytoplasm during schizont and trophozoite
  • "In contrast, substantial 1-Cys Prx staining was detected only in a small number of trophozoites in the cytoplasm ( Fig. 3G,H). Expression of 1-Cys Prx in schizonts was very weak ( Fig. 3H) in comparison with that in parasites of the same stage stained with anti-2-Cys Prx serum ( Fig. 3D)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to homologue
  • Strain: 17XL
  • Gene model mapping comments: Blast from AB089300, annotation matches
  • Localisation record: cytoplasm during trophozoite, very weak cytoplasm during schizont
  • Other genes localised in this publication: thioredoxin peroxidase 1, 28 kDa ookinete surface protein

   15387810 (unpublished) full text
   more detail about this publication

during not ookinete and not sporozoite and not zygote
  • "In contrast, 1-Cys Prx was not detected during the zygote, ookinete, and sporozoite stages (data not shown)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to homologue
  • Strain: 17XL
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not during zygote and ookinete and sporozoite
  • Other genes localised in this publication: thioredoxin peroxidase 1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10063

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PY04285 1-cys peroxidoxin
MGYHLGATFPNFTAKASGIDGDFELYKYIENSWAILFSHPNDFTPVCTTELAELGKMHEDFLKLNCKLIGFSCNSKESHD
KWIEDIKYYGKLNKWEIPIVCDESRELANKLKIMDEQEKDITGLPLTCRCLFFISPEKKIKATVLYPATTGRNAHEILRV
LKSLQLTYTTPVATPVNWNEGDKCCVIPTLQDDEISKHFKNEITKVEMPSKKKYLRFVNL

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY04285

General Sub-Cellular Localisation Links