ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY03846 (FabI)

enoyl-acyl carrier reductase, a gene from Plasmodium yoelii

Compiled localisation
nowhere except apicoplast during hepatocyte schizont and salivary gland sporozoite
during not blood stages and not oocyst sporozoite and not oocyst
apicoplast during 14 hours post sporozoite infection and 24 hours post sporozoite infection and 40 hours post sporozoite infection and 48 hours post sporozoite infection and 7 hours post sporozoite infection and salivary gland sporozoite

Who localised this protein by microscopy?

Pei, Y., Tarun, A. S., Vaughan, A. M., Herman, R. W., Soliman, J. M., Erickson-Wayman, A., Kappe, S. H.
Plasmodium pyruvate dehydrogenase activity is only essential for the parasite's progression from liver infection to blood infection. (2010 Jan 5, Mol Microbiol) PubMed / full text
   more detail about this publication

nowhere except apicoplast during hepatocyte schizont and salivary gland sporozoite
  • "To confirm apicoplast localization of E1α and E3, we generated an antibody against P. yoelii FabI to be used as an apicoplast marker and utilized this antibody in subsequent IFAs. The co-localization of E1α-myc and E3-myc with FabI confirmed that PDH, as previously shown for P. falciparum (Foth et al., 2005) is exclusively targeted to the apicoplast in P. yoelii (Figure 2B & 2D)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 17XNL
  • Gene model mapping comments: Orthology via OrthoMCL to P. falciparum
  • Localisation record: nowhere except apicoplast during salivary gland sporozoite and liver stage schizont
  • Other genes localised in this publication: pyruvate dehydrogenase E1 alpha subunit, dihydrolipoamide dehydrogenase, U43539 hepatocyte erythrocyte protein 17 kDa, merozoite surface protein 1 precursor

Vaughan, A. M., O'Neill, M. T., Tarun, A. S., Camargo, N., Phuong, T. M., Aly, A. S., Cowman, A. F., Kappe, S. H.
Type II fatty acid synthesis is essential only for malaria parasite late liver stage development. (2009 Mar, Cell Microbiol) PubMed / full text
   more detail about this publication

during not blood stages and not oocyst and not oocyst sporozoite, apicoplast during 14 hours post sporozoite infection and 24 hours post sporozoite infection and 40 hours post sporozoite infection and 48 hours post sporozoite infection and 7 hours post sporozoite infection and salivary gland sporozoite
  • "FabI-myc expression was not detectable in the developing mosquito midgut oocysts and also not in oocyst sporozoites (Fig. S2). .. we assume that the FabI-myc expression we detected in salivary gland sporozoites is apicoplast specific (Fig. 2A). .. These results show that FabI expression is initiated in salivary gland sporozoites and that there is robust apicoplast-specific FabI expression throughout liver stage development."
  • Microscopy type: Light
  • Microscopy method: myc tag
  • Strain: 17XNL
  • Gene model mapping comments: inferred from another publication
  • Localisation record: not during mosquito midgut oocysts and oocyst sporozoites and blood stages, apicoplast during salivary gland sporozoites and 7 hours post sporozoite infection and 14 hours post sporozoite infection and 24 hours post sporozoite infection and 40 hours post sporozoite infection and 48 hours post sporozoite infection
  • Other genes localised in this publication: circumsporozoite protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13747

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PY03846 enoyl-acyl carrier reductase
MYKKVILFLIISIFNYLKITCFTNTGYEKKTFPSLRMNKENYWKNKILRKNKNENNLRINVGSSQNDIIENIKNGSENGS
VSGSESGSEICFIAGVGDSNGYGWGIAKELSKRNVKVIFGVWPPVYNIFIKNLESGKFDKDMIINNDNLKRMEILDVLPL
DAGFDNYDDIDEDTKNNKRYNNLKNYSIEEVANLIYNKYGKISMLVHSLANGREVQKSLLDTSRDGYLDAISKSSYSLIS
LCKHFCKFMNPGGSIVSLTYQASQKVVPGYGGGMSSAKAALESDTRVLAYYLGRKYNIRINTISAGPLKSRAATAINKFN
NNQKNNMNSSGENDKQNYSFIDYAIDYSEKYAPLKKKLLSTDVGSVASFLLSKESSAVTGQTIYVDNGLNIMFGPDDLFQ
ASDS

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY03846

General Sub-Cellular Localisation Links