ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY03168 (CS, CSP, S2)

circumsporozoite protein, a gene from Plasmodium yoelii

Compiled localisation
cytoplasmic matrix and endoplasmic reticulum and subcapsular areas during 7 day old oocyst
microneme during sporozoite
surface during salivary gland sporozoite and sporozoite
during salivary gland sporozoite

Who localised this protein by microscopy?

Vaughan, A. M., O'Neill, M. T., Tarun, A. S., Camargo, N., Phuong, T. M., Aly, A. S., Cowman, A. F., Kappe, S. H.
Type II fatty acid synthesis is essential only for malaria parasite late liver stage development. (2009 Mar, Cell Microbiol) PubMed / full text
   more detail about this publication

during salivary gland sporozoite
  • "The salivary gland sporozoite was detected with a mouse anti-circumsporozoite protein (CSP) antibody and the liver stage cytoplasm was detected with a mouse anti-heat shock protein 70 (HSP70) antibody."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 17XNL
  • Gene model mapping comments: inferred from another publication
  • Localisation record: during salivary gland sporozoite
  • Other genes localised in this publication: enoyl-acyl carrier reductase

Kaiser, K., Matuschewski, K., Camargo, N., Ross, J., Kappe, S. H.
Differential transcriptome profiling identifies Plasmodium genes encoding pre-erythrocytic stage-specific proteins. (2004 Mar, Mol Microbiol) PubMed / full text
   more detail about this publication

surface during salivary gland sporozoite

Tsuji, M., Corradin, G., Zavala, F.
Monoclonal antibodies recognize a processing dependent epitope present in the mature CS protein of various plasmodial species. (1992 Sep, Parasite Immunol) PubMed / full text
   more detail about this publication

cytoplasmic matrix and endoplasmic reticulum and subcapsular areas during 7 day old oocyst, microneme and surface during sporozoite
  • "Fig. 1. Section of a 7-day-old Plasmoda4m yoIll oocyst Incubated with MAb NYSI against CS protein and Immunoglobuln-gold. Gold particles are associated with the endoplasmic reticulum (ER), cytoplasmic matrix and subcapsular areas ... Fig. 3. Section of a alivary gland sporozolto (S) Incubated with MAb NYS3 against CS protein and Immunoglobulin-goid. Gold label is associated with the surface (arrow), and micronemes (Mi)."
  • Microscopy type:
  • Microscopy method:
  • Strain: 17XNL
  • Gene model mapping comments: Blast from homologue PFC0210c, annotation matches
  • Localisation record: ER and cytoplasmic matrix and subcapsular areas during 7 day old oocyst, microneme and surface during sporozoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_40533

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PVX_119355 circumsporozoite protein precursor, putative
  • PVX_187290 circumsporozoite protein, truncated, putative
  • PKH_083560 circumsporozoite (CS) protein precursor
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PY03168 circumsporozoite protein
PPQQPPQQPPQQPPQQPPQQPPQQPPQQPRPQPDGNNNNNNNNGNNNEDSYVPSAEQILEFVKQISSQLTEEWSQCSVTC
GSGVRVRKRKNVNKQPENLTLEDIDTEICKMDKCSSIFNIVSNSLGFVILLVLVFFN

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY03168

General Sub-Cellular Localisation Links