ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY03052 (TRAP)

sporozoite surface protein 2 precursor, a gene from Plasmodium yoelii

Compiled localisation
surface during ookinete
microneme during hemolymph sporozoite and salivary gland sporozoite
apical and basal and not nucleus during salivary gland sporozoite

Who localised this protein by microscopy?

Mikolajczak, S. A., Silva-Rivera, H., Peng, X., Tarun, A. S., Camargo, N., Jacobs-Lorena, V., Daly, T. M., Bergman, L. W., de la Vega, P., Williams, J., Aly, A. S., Kappe, S. H.
Distinct malaria parasite sporozoites reveal transcriptional changes that cause differential tissue infection competence in the mosquito vector and mammalian host. (2008 Oct, Mol Cell Biol) PubMed / full text
   more detail about this publication

microneme during hemolymph sporozoite
  • "Interestingly, simultaneous staining of UOS3myc and TRAP, a known micronemal protein, showed only a partial overlap in localization (Fig. 8F)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 17XNL
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during hemolymph sporozoite
  • Other genes localised in this publication: 250-270 copies of a 13 AA repeat, NSSTPITSSSIL

Kaiser, K., Matuschewski, K., Camargo, N., Ross, J., Kappe, S. H.
Differential transcriptome profiling identifies Plasmodium genes encoding pre-erythrocytic stage-specific proteins. (2004 Mar, Mol Microbiol) PubMed / full text
   more detail about this publication

apical and basal and microneme and not nucleus during salivary gland sporozoite
  • "A. Dual indirect immunofluorescence assay (IFA) on salivary gland sporozoites with antiserum specific for PyTRAP, a sporozoite micronemal protein, and with antiserum specific for PyTRSP. TRAP staining is internal and not restricted to one pole of the sporozoite. TRSP has a different distribution, showing an internal, bilobed staining pattern that extends from the nuclear region to the apical end of the sporozoite where the two lobes seemingly converge. … A. Dual IFA with antiserum specific for PyS3 and antiserum specific for PyTRAP. The merged fluorescent image reveals highly similar S3 and TRAP staining patterns, both showing internal, granular localization that is not restricted to one pole of the sporozoite and excluded from the nuclear region. "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 17XNL
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme and apical and basal and not nuclear during salivary gland sporozoite
  • Other genes localised in this publication: hypothetical protein, circumsporozoite protein, hypothetical protein, early transcribed membrane protein family

Gantt, S., Persson, C., Rose, K., Birkett, A. J., Abagyan, R., Nussenzweig, V.
Antibodies against thrombospondin-related anonymous protein do not inhibit Plasmodium sporozoite infectivity in vivo. (2000 Jun, Infect Immun) PubMed / full text
   more detail about this publication

surface during ookinete
  • "Sporozoites in contact with cells often displayed bright cap patterns of surface TRAP labeling. "
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody to homologue
  • Strain:
  • Gene model mapping comments: Blast from N terminus DEIKYSEEVC from paper
  • Localisation record: surface during ookinete
  • Comment: Couldn't find strain information
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_33736

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PVX_082735 sporozoite surface protein 2
  • PCHAS_135440 thrombospondin-related anonymous protein, putative
  • PKH_121770 sporozoite surface protein 2, putative
  • TA07755 thrombospondin-related protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PY03052 sporozoite surface protein 2 precursor
MKLLGNSKYIFVVLLLCISVFLNGQETLDEIKYSEEVCTEQIDIHILLDGSGSIGYSNWKAHVIPMLNTLVDNLNISNDE
INVSLTLFSTNSRELIKLKGYGSTSKDSLRFILAHLQNNYSPNGNTNLTSALLVVDTLINERMYRPDAIQLAIILTDGIP
NDLPRSTAVVHQLKRKHVNVAIIGVGAGVNNEYNRILVGCDRYAPCPYYSSGSWNEAQNMIKPFLTKVCQEVERIAHCGK
WEEWSECSTTCDEGRKIRRRQILHPGCVSEMTTPCKVRDCPQIPIPPVIPNKIPEKPSNPEEPVNPNDPNDPNNPNNPNN
PNNPNNPNNPNNPNNPNNPNNPNNPNNPNNPNNPNNPNNPNNPNNPNNPNNPNNPNNPNNPNDPSNPNNPNPKKRNPKRR
NPNKPKPNKPNPNKPNPNEPSNPNKPNPNEPSNPNKPNPNEPSNPNKPNPNEPSNPNKPNPNEPLNPNEPSNPNEPSNPN
APSNPNEPSNPNEPSNPNEPSNPNEPSNPNEPSNPKKPSNPNEPSNPNEPLNPNEPSNPNEPSNPNEPSNPEEPSNPKEP
SNPNEPSNPEEPNPEEPSNPKEPSNPEEPINPEELNPKEPSNPEESNPKEPINPEESNPKEPINPEDNENPLIIQDEPIE
PRNDSNVIPILPIIPQKGNNIPSNLPENPSDSEVEYPRPNDNGENSNNTMKSKKNIPNEPIPSPGDNPYKGHEERIPKPH
RSNDDYVYDNNVNKNNKDEPEIPNNEYEEDKNKNQSKSNNGYKIAGGIIGGLAILGCAGVGYNFIAGSSAAGLAGAEPAP
FEDVIPDDDKDIVENEQFKLPEDNDWN

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY03052

General Sub-Cellular Localisation Links