ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY03011 (S7)

early transcribed membrane protein family, a gene from Plasmodium yoelii

Compiled localisation
apical and basal and not nucleus during salivary gland sporozoite

Who localised this protein by microscopy?

Kaiser, K., Matuschewski, K., Camargo, N., Ross, J., Kappe, S. H.
Differential transcriptome profiling identifies Plasmodium genes encoding pre-erythrocytic stage-specific proteins. (2004 Mar, Mol Microbiol) PubMed / full text
   more detail about this publication

apical and basal and not nucleus during salivary gland sporozoite
  • "B. Dual IFA with antiserum specific for PyS3 and antiserum for PyS7. The merged fluorescent image reveals extensive but not complete overlap of the S3 and S7 signals. Like S3, S7 shows internal, granular localization that is not restricted to one pole of the sporozoite and excluded from the nuclear region."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 17XNL
  • Gene model mapping comments: Blast from EAA22537
  • Localisation record: apical and basal and not nuclear during salivary gland sporozoite
  • Other genes localised in this publication: sporozoite surface protein 2 precursor, hypothetical protein, circumsporozoite protein, hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48314

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PY03011 early transcribed membrane protein family
MPQFFTCIIYINKYFRTNKKYMKVYKMNTLKVFFVFYVLYITTFFFNPCFCEDADYYSEIDDGALDSIDTAIKKKKKRKS
VAIALLSSGLVASVIGVLYYMYKSHNKGRHDWNKGFNFFPFNKQTEYKQPDGEKPSTSTKYEEPLGVNKVNIKGKLKENN
NDIDVPLKRFNTFMDNVKLAAKHHFSNLSNEQQKYLIKDYDYLRKIVQTLDENKDVNISRAQEDIAVLGVEHFLKEQYQP
K

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY03011

General Sub-Cellular Localisation Links