ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY01581 (AMA1)

apical membrane antigen-1, a gene from Plasmodium yoelii

Compiled localisation
rhoptry during late schizont
microneme during individual merozoites and schizont and segmented schizont
not dense granule during individual merozoites and segmented schizont

Who localised this protein by microscopy?

Ogun, S. A., Tewari, R., Otto, T. D., Howell, S. A., Knuepfer, E., Cunningham, D. A., Xu, Z., Pain, A., Holder, A. A.
Targeted disruption of py235ebp-1: invasion of erythrocytes by Plasmodium yoelii using an alternative Py235 erythrocyte binding protein. (2011 Feb, PLoS Pathog) PubMed / full text
   more detail about this publication

microneme during schizont
  • "The pattern of reactivity (Figure 3B) was similar but not identical to that of antibodies specific for the micronemal protein, Apical Membrane Antigen 1 (AMA1) [39], the erythrocyte binding ligand protein (EBL), which has a dense granule location in this parasite line [40], and rhoptry neck protein 4 (RON 4) [41]."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody
  • Strain: YM
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during schizont
  • Other genes localised in this publication: rhoptry protein, duffy receptor, beta form precursor, Drosophila melanogaster CG15040 gene product

Otsuki, H., Kaneko, O., Thongkukiatkul, A., Tachibana, M., Iriko, H., Takeo, S., Tsuboi, T., Torii, M.
Single amino acid substitution in Plasmodium yoelii erythrocyte ligand determines its localization and controls parasite virulence. (2009 Apr 28, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

microneme and not dense granule during individual merozoites and segmented schizont
  • "In the 17X line, PyEBL localized to the apical end of each merozoite in both the segmented schizont-stage parasite and individual merozoites, where it colocalized with AMA1, a known microneme protein, under immunofluorescent microscopy (Fig. 2B)."
  • Microscopy type: Fixed Light
  • Microscopy method: polyclonal antibody
  • Strain: 17X, 17XL, YM
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme and not dense granule during segmented schizont-stage and individual merozoites
  • Other genes localised in this publication: duffy receptor, beta form precursor

Noe, A. R., Adams, J. H.
Plasmodium yoelii YM MAEBL protein is coexpressed and colocalizes with rhoptry proteins. (1998 Oct 30, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during late schizont
  • "The IFA studies showed that antibodies to MAEBL reacted to parasites with a punctate double dot fluorescence pattern characteristic of rhoptry proteins and that MAEBL colocalized with two known rhoptry proteins, AMA-1 and the 235 kDa rhoptry proteins."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody to homologue
  • Strain: YM
  • Gene model mapping comments: Blast from homologue PF11_0344, annotation matches
  • Localisation record: rhoptry during mature schizont
  • Other genes localised in this publication: erythrocyte binding protein, merozoite surface protein 1 precursor

Orthology

OrthoMCL

Part of OrthoMCL group OG4_27887

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PY01581 apical membrane antigen-1
MKEIYYIFILCSIYLINLSYCSEGPNQVISEDGNINYESIPKENTERSIKLINPWDKYMEKYDIEKVHGSGIRVDLGEDA
RVENRDYRIPSGKCPVIGKGITIQNSEVSFLKPVATGDKPVRSGGLAFPETDVHISPITITNLKTMYKDHQDIVNLNDMS
LCAKHTSLYVPGKDATSAYRHPVVYDKSNSTCYMLYVAAQENMGPRYCSNDANNENQPFCFTPEKIENYKDLSYLTKNLR
DDWETSCPNKSIKNAKFGIWVDGYCTDYQKHVVHDSDSLLKCNQIIFNESASDQPKQYERHLEDATKIRQGIVERNGKLI
GEALLPIGSYKSGQIKSHGKGYNWGNYDSKNNKCYIFETKPTCLINDKNFIATTALSSTEEFEENFPCEIYKNKIAEEIK
VLNLNQNTSNGNNSIKFPRIFISTDKNSLNCPCDPTKLTESTCEFYVCSCVEQRQYIAENNDVIIKEEFIGDYENPKQKL
LIIIVLIGVGIIIVILLVAYYFKSGKKGENYDRMGQADDYGKSKSRKDEMLDPEVSFWGEDKRASHTTPVLMEKPYY

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY01581

General Sub-Cellular Localisation Links