ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY01232 (MyoA)

myosin A, a gene from Plasmodium yoelii

Compiled localisation
inner membrane complex during late schizont and merozoite and sporozoite

Who localised this protein by microscopy?

Bergman, L. W., Kaiser, K., Fujioka, H., Coppens, I., Daly, T. M., Fox, S., Matuschewski, K., Nussenzweig, V., Kappe, S. H.
Myosin A tail domain interacting protein (MTIP) localizes to the inner membrane complex of Plasmodium sporozoites. (2003 Jan 1, J Cell Sci) PubMed / full text
   more detail about this publication

inner membrane complex during late schizont and merozoite and sporozoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10145

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PY01232 myosin A
MAVTNEELKTAHKIVRRVSNIEAFDKSGVVFKGYQIWTNISPTIEEDPNVMFVKCVVQHGSNQDKLNVVQIDPPGSGTPY
EIDVKSAWNCNSQVDPMSFGDIGLLNHTNTPCVLDFLKHRYLKNQIYTTACPLIVAINPYKDLGNTTDEWIRKYRDASDH
TRLPPHIFSCAREALSNLHGVNKSQTIIVSGESGAGKTEATKQIMKYFASSKNGNMDLYIQTAIMAANPVLEAFGNAKTI
RNNNSSRFGRFMQLAISHEGGIRNGSVVAFLLEKSRIITQDDNERSYHIFYQFLKGADSNMKSKFGLKGIKDYKLLNPNS
PDVDGIDDVKDFQEVITSLKNMQLNDEQIEVIFSIIAGILTLGNVRIVEKTEAGLSDAAGIHNDDMETFKKACELMFLDP
ELVKRELLIKVTIAGGNRIEGRWNKNDAEVLKLSLCKAMYEKLFLWIIKNLNSRIEPEGGFKAFMGMLDIFGFEVFKNNS
LEQLFINITNEMLQKNFVDIVFERESKLYRDEGISTAELNYTSNKEVISVLCERGKSVLSYLEDQCLAPGGSDEKFVNAC
VVNLKSNEKFIPAKVASNKNFIIQHTIGPIQYCSDNFLLKNKDVLRGELVEIILGSGNKVVSGLFEGQVIEKGKMAKGSL
IGSQFLNQLTSLMTLINSTEPHFIRCIKPNENKKPLEWCEPKILIQLHALSILEALVLRQLGYSYRRTFDEFLYQFKFVD
INTSENSSLDSREKCNKILKLSGLSDDMLKIGKTMVFLKQDGAKMLSKIQREKLVEWENCVSVIEAAIMKYKHKQNVENN
VSSLMRVQAHIRKRMVA

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY01232

General Sub-Cellular Localisation Links