ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY00830 ()

probable ATP-dependent RNA helicase has1, a gene from Plasmodium yoelii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11546

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFF1500c DEAD/DEAH box ATP-dependent RNA helicase
  • PBANKA_112970 DEAD/DEAH box ATP-dependent RNA helicase, putative
  • PY00830 probable ATP-dependent RNA helicase has1
  • PVX_114645 DEAD/DEAH box ATP-dependent RNA helicase, putative
  • PCHAS_112920 DEAD/DEAH box ATP-dependent RNA helicase, putative
  • PKH_111800 DEAD/DEAH box ATP dependent DNA helicase, putative
  • TGME49_112990 ATP-dependent RNA helicase, putative
  • NCLIV_056340 ATP-dependent RNA helicase DDX55 (EC 3.6.1.-), related
  • cgd3_3920 DEAD/DEAH box ATP-dependent RNA helicase, putative
  • Chro.30442 DEAD/DEAH box ATP-dependent RNA helicase
  • CMU_032070 DEAD/DEAH box ATP-dependent RNA helicase, putative
  • TA11380 DEAD-box family ATP-dependent helicase, putative
  • BBOV_III009130 DEAD/DEAH box domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PY00830 probable ATP-dependent RNA helicase has1
MHSSKEKICHKEDGPSTNVDNAENENDVDNAENEKNKNNELDVDNAEDAENAENENDVDNTENEKNKNNELDAENAENEN
NELDVDNAENAEDGKETKKRSRQNDDKDINDLGPKKIKQTDISEEDNQNGMEEKCDKLNIIDQNEMQTKGEDDQTEIQTK
GEDDQNEMQTKGEDDQNEMQTKGEGDQNEMQTKGEDDKNGEGEKSINYKNCAISNKKSEKENFYSEQKFEDLDICDALKK
GLKELNFITLTEIQSKCIPHFLNGKDILGAAKTGSGKTLAFLVPSIHILYNIKFLPKNGTGVLIISPTRELCLQIYQVCT
DLCKYIPQTNGIIIGGVSRNEEKKKFIHGINILIATPGRLLDHMQNTKEFNYKNLVCLIIDEADRLLQIGFEEEINLIVK
RLPKKRQTALFSATQTTKVESLIRLSLQKPIFIEVTTKIATVERLQQGYALVDEDKRFLLLFTFLKRNTSKKIMVFFNNC
MSVQFYNDLLNYIDIPTFCIHGKKKQNQRLKSFNEFSAAKNAILLCTNVAARGLDIPNVNYIIQYDPPDDSKEYIHRVGR
TCRGNDSAGSAIIFLMKHELKFLNYLKFYNIPVNQFSYDQKKLINIQSQMESIVTKNFHLHKMAREAFKSYLNVIINLSP
KKKKKKKKI

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY00830

General Sub-Cellular Localisation Links