ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY00573 (PDH E3)

dihydrolipoamide dehydrogenase, a gene from Plasmodium yoelii

Compiled localisation
during not schizont
nowhere except apicoplast during hepatocyte schizont and salivary gland sporozoite

Who localised this protein by microscopy?

Pei, Y., Tarun, A. S., Vaughan, A. M., Herman, R. W., Soliman, J. M., Erickson-Wayman, A., Kappe, S. H.
Plasmodium pyruvate dehydrogenase activity is only essential for the parasite's progression from liver infection to blood infection. (2010 Jan 5, Mol Microbiol) PubMed / full text
   more detail about this publication

during not schizont, nowhere except apicoplast during hepatocyte schizont and salivary gland sporozoite
  • "However, no significant E1α-myc expression was detected in schizonts (Figure 1A & 1B) or other blood stage forms of the parasite (data not shown) when probed with a number of anti-myc antibodies. … P. yoelii PDH E1α-myc and E3-myc subunits localize to the apicoplast of sporozoites and liver stages"
  • Microscopy type: Light
  • Microscopy method: myc tag
  • Strain: 17XNL
  • Gene model mapping comments: Orthology via OrthoMCL to T. gondii
  • Localisation record: not during schizont, nowhere except apicoplast during salivary gland sporozoite and liver stage schizont
  • Other genes localised in this publication: pyruvate dehydrogenase E1 alpha subunit, U43539 hepatocyte erythrocyte protein 17 kDa, merozoite surface protein 1 precursor, enoyl-acyl carrier reductase

Orthology

OrthoMCL

Part of OrthoMCL group OG4_18600

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PY00573 dihydrolipoamide dehydrogenase
MNKIQLHKFYTIILICVSFLFILNKNEGVKISQNVKSISAFNTNWKMEKGYHDSIQCNTTLFPCKKKKKFFIESKNYKFI
CPKNGNLRYSKKIKTKPGAKSENNDTSKMEIYPDQYDVAILGCGVGGHAAAINAIEKNLKVIIFAGNEESLGGTCVNVGC
IPSKALLYATNKYRELKNISKLCNYGIYSNAYIDKEKDEIKSTQLIADSICINTNKLKEYTQNVIKKLKSGITHGMKNTK
FNKNPQSVQVIYDHGYIINKNTIQSKKNKQLYKAKNIILATGSIPNVPQNINVDHKTVFTSDQAINLQGLQNYISIIGMG
IIGLEFSDIYTALGSEITFFEYSPEFLPFVDTDIAKYFENVFLKTKPINYFLNTEIKYVHPASNGKPVVIGYSLRTKTNP
DSTASTTQINGEHVKELHVDSCLVATGRKPNTENIGLENLNAKMNKGFVLVDDQLRVQIEPIQKTDQKNANTNELNQSID
TQVYDNIFCIGDANGKQMLAHTASHQALRVIDYIAKKEKKEEKEEIINPIENILNKPIIYKNIPSVCYTNPELAFVGFSE
KDANKLYPDSIDVEITYYKSNSKILCENNISLNNNKNNSYNKGSYNFNDNSNGMVKMVYNKYTKQLLGVFIVGNYASILI
HEAVLAINHNLTIYDLAYMVHSHPTVTEVLDTTFKSASGIRTH

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY00573

General Sub-Cellular Localisation Links