PY00522 (Pys25)
28 kDa ookinete surface protein, a
gene from Plasmodium yoelii
Compiled localisation
surface during ookinete
cytoplasm during gametocyte
Who localised this protein by microscopy?
Muller, S. Redox and antioxidant systems of the malaria parasite Plasmodium falciparum. (2004 Sep, Mol Microbiol)
PubMed /
full text
   more detail about this publication
cytoplasm during gametocyte
-
"Simultaneous application of the mouse monoclonal antibody to Pys25, a molecule expressed in the cytoplasm of P. yoelii gametocytes, with rabbit anti-Prx serum differentiated gametocytes from trophozoites and schizonts on merged images of Alexa Fluor 546 (red) and FITC (green) staining (Fig. 3D)."
-
Microscopy type: Light
-
Microscopy method: polyclonal antibody directly to homologue
-
Strain: 17XL
-
Gene model mapping comments: inferred from another publication
-
Localisation record: cytoplasm during gametocyte
- Other genes localised in this publication:
thioredoxin peroxidase 1, 1-cys peroxidoxin
Tsuboi, T., Cao, Y. M., Hitsumoto, Y., Yanagi, T., Kanbara, H., Torii, M. Two antigens on zygotes and ookinetes of Plasmodium yoelii and Plasmodium berghei that are distinct targets of transmission-blocking immunity. (1997 Jun, Infect Immun)
PubMed /
full text
   more detail about this publication
surface during ookinete
-
"We have developed transmission-blocking monoclonal antibodies (MAbs) against Plasmodium yoelii 21-kDa (Pys21) and 28-kDa (Pys25) ookinete surface proteins."
-
Microscopy type: EM
-
Microscopy method: monoclonal antibody
-
Strain:
-
Gene model mapping comments: Blast from D89082 from 9233679 , annotation matches
-
Localisation record: surface during ookinete
- Other genes localised in this publication:
-
Orthology
OrthoMCL
Part of OrthoMCL group OG4_33730
Localised Genes in this Group
-
PBANKA_051500 (P25, P28, Pbs25): ookinete surface during macrogamete, surface during day 5 oocyst and macrogamete and oocyst and ookinete and zygote, gliding trail during ookinete, plasma membrane during ookinete, cytoplasm during day 5 oocyst
-
PVX_111175 (Pvs25, Pvs28): intracellular during zygote, ookinete surface
-
PY00522 (Pys25): surface during ookinete, cytoplasm during gametocyte
-
PF10_0303 (Pfs25, P25): vesicle during emerged gametocyte and non-activated gametocyte, parasite plasma membrane during emerging gametocyte and gamete formation and ookinete
Other Apicomplexan Genes in this Group
-
PCHAS_051510 25 kDa ookinete surface antigen precursor, putative
-
PKH_061530 Ookinete surface protein Pvs25, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
There are no non-apicomplexan genes that have manually annotated evidence codes.
Amino Acid Sequence
>PY00522 28 kDa ookinete surface protein
MNTYYSVFLFIYAFLGINYYNAAITPATQCKNGFLAQMSNHLECRCNNNFVHVSNDTCETKVECSKATVNKPCGEFSKCT MHEDEGVETYTCDCLDTYIKKNDVCVPETCQNIDCGNGKCIINEDAVNDPPTCSCNIGYVVNVDDGSKCTKEGDTLCSLV CNKEEQICKKVDSYYRCDCKDGFKLSVEEEKCISHSIYSMFNLSIIFAILLLFSNII
Proteomics
Found in:
Not found in:
Gene-Specific Links for PY00522
General Sub-Cellular Localisation Links
-
PlasmoDB:
-
TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
-
OrthoMCL, automatic clustering of orthologous groups of proteins
|