ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY00414 (2-Cys Prx)

thioredoxin peroxidase 1, a gene from Plasmodium yoelii

Compiled localisation
cytoplasm during gametocyte and ookinete and schizont and sporozoite and trophozoite and zygote
not nucleus and not plasma membrane during gametocyte and schizont and trophozoite

Who localised this protein by microscopy?

Muller, S.
Redox and antioxidant systems of the malaria parasite Plasmodium falciparum. (2004 Sep, Mol Microbiol) PubMed / full text
   more detail about this publication

cytoplasm during gametocyte and ookinete and schizont and sporozoite and trophozoite, not nucleus and not plasma membrane during gametocyte and schizont and trophozoite
  • "Immunofluorescence microscopy of P. yoelii blood-stage parasites revealed that 2-Cys Prx was expressed in the parasite cytoplasm during the early to late trophozoite, schizont, and gametocyte stages (Fig. 3C,D). … Immunostaining of insect-stage parasites with anti-serum against 2-Cys Prx revealed that 2-Cys Prx was expressed throughout the cytoplasm of ookinetes and sporozoites (Fig. 3I–L). 2-Cys Prx was also detected in the cytoplasm of zygotes (data not shown)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to homologue
  • Strain: 17XL
  • Gene model mapping comments: Blast from AB089301, annotation doesn't match
  • Localisation record: cytoplasm during ookinete and sporozoite, cytoplasm and not nuclei and not plasma membranes during trophozoite and schizont and gametocyte
  • Other genes localised in this publication: 1-cys peroxidoxin, 28 kDa ookinete surface protein

   15387810 (unpublished) full text
   more detail about this publication

cytoplasm during zygote
  • "2-Cys Prx was also detected in the cytoplasm of zygotes (data not shown)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to homologue
  • Strain: 17XL
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytoplasm during zygote
  • Other genes localised in this publication: 1-cys peroxidoxin

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10063

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PY00414 thioredoxin peroxidase 1
MPSIVGNQAPSFKAEAVFGDNTFGEVSLSDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDSFKERNVELLGCSVDSKF
THLAWKKTPLSQGGIGNIKHTLISDISKSIARSYDVLFNESVALRAFVLIDKQGVVQHLLVNNLALGRSVDEILRLIDAL
QHHEKYGDVCPANWQKGKESMKPSEEGVAKYLSNL

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY00414

General Sub-Cellular Localisation Links