ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY00409 (MTIP)

myosin A tail domain interacting protein MTIP, a gene from Plasmodium yoelii

Compiled localisation
inner membrane complex during late schizont and merozoite and sporozoite

Who localised this protein by microscopy?

Bergman, L. W., Kaiser, K., Fujioka, H., Coppens, I., Daly, T. M., Fox, S., Matuschewski, K., Nussenzweig, V., Kappe, S. H.
Myosin A tail domain interacting protein (MTIP) localizes to the inner membrane complex of Plasmodium sporozoites. (2003 Jan 1, J Cell Sci) PubMed / full text
   more detail about this publication

inner membrane complex during late schizont and merozoite and sporozoite
  • "Indirect immunofluorescence assay (IFA) with anti-MTIP antiserum showed that MTIP is concentrated around the periphery of merozoites during the late stages of blood stage schizogony (Bar, 2 ᄉm). (C) IFA with anti-MTIP showed strong peripheral fluorescence in P. yoelii sporozoites that were isolated from mosquito salivary glands "
  • Microscopy type: Light, EM
  • Microscopy method: antibody to native protein
  • Strain: 17XL
  • Gene model mapping comments: Blast from AAL69979.1
  • Localisation record: IMC during late schizont and merozoite and sporozoite
  • Other genes localised in this publication: myosin A, myosin A tail domain interacting protein MTIP, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23366

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PY00409 myosin A tail domain interacting protein MTIP
MEQQCHACYFELPDPKTTIGPYDSELNYFMWGPGFEWKPEPVVSQISGEDTYDETEESEESEHGFDELDEKVNKDDRKRY
FDEKSSGGKISIENASHNARRLGLAPSSKDEEKIRELYGDNLTYDQYLEYLSMSIHDKDNAEQLVKMFAYFDTNTTGYLT
KNQMKNILITWGDALTEDEAMNALNAFSNDDKIDYKLFCEDILQ

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY00409

General Sub-Cellular Localisation Links