ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PY00204 (S3, UIS4)

hypothetical protein, a gene from Plasmodium yoelii

Compiled localisation
apical and basal and not nucleus during salivary gland sporozoite

Who localised this protein by microscopy?

Kaiser, K., Matuschewski, K., Camargo, N., Ross, J., Kappe, S. H.
Differential transcriptome profiling identifies Plasmodium genes encoding pre-erythrocytic stage-specific proteins. (2004 Mar, Mol Microbiol) PubMed / full text
   more detail about this publication

apical and basal and not nucleus during salivary gland sporozoite
  • "A. Dual IFA with antiserum specific for PyS3 and antiserum specific for PyTRAP. The merged fluorescent image reveals highly similar S3 and TRAP staining patterns, both showing internal, granular localization that is not restricted to one pole of the sporozoite and excluded from the nuclear region. "
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: 17XNL
  • Gene model mapping comments: Blast from EAA21410
  • Localisation record: apical and basal and not nuclear during salivary gland sporozoite
  • Other genes localised in this publication: sporozoite surface protein 2 precursor, hypothetical protein, circumsporozoite protein, early transcribed membrane protein family

Orthology

OrthoMCL

Part of OrthoMCL group OG4_84497

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PY00204 hypothetical protein
MKTTYVSLFFIILLICGIFECKASSVDETNDPKPNNVKLTDKINSIFKNKRNGKIAAIAASIAGSTIAIALALACMHPEV
REKFGIRKRIKNFDDVNTPQDISLISPVENPYQEYYPEDYQEQYPEISSDQYIEQPQKHYTKRFLEQYTNSVQNDHTYSY
SPTEEKYNTYYMAPDTHDEYEKLFTDDQKEEINDNIVYHDELSDLMGEGHKIYSMNDKPFDPYI

Proteomics

Found in:

Not found in:

Gene-Specific Links for PY00204

General Sub-Cellular Localisation Links