ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_118180 (LAP)

leucine aminopeptidase, putative, a gene from Plasmodium vivax

Compiled localisation
cytosol and not food vacuole and not nucleus

Who localised this protein by microscopy?

Lee, J. Y., Song, S. M., Seok, J. W., Jha, B. K., Han, E. T., Song, H. O., Yu, H. S., Hong, Y., Kong, H. H., Chung, D. I.
M17 leucine aminopeptidase of the human malaria parasite Plasmodium vivax. (2010 Mar, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytosol and not food vacuole and not nucleus
  • "As shown in Fig. 1D, the distribution of the PvLAP was distinct from the lysosome and nucleus, and showed strong immunoreactivity throughout the parasite cytoplasm, indicating that that PvLAP is localized in the cytosol of the parasite."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody to whole protein
  • Strain:
  • Gene model mapping comments: blast from XP_001615930, annotation matches
  • Localisation record: cytosol and not lysosome and not nucleus
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10695

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PVX_118180 leucine aminopeptidase, putative
MPLLRSSQHIKNTYWNIPKKSFRTGVPQFAESKKTRILHLHPLCKSASGVESPPFFDSQTFSSISNRKEFRKMATTVPQV
VSLDPTTIPIDYHTPIDDLSIEVKDISAEACPADEGLIVFLLNSAPKHSSSGGSGGNGGSAGSSGNGEGGAQIKINSSVK
DNTINEFLKEGNMENFTGKLGTSKSFYIANDQKKYVSLAYVGCGPANEETELEIRKVAYALVTLLHDSKHKKVSIIFEIK
IEEALFRFFLEHLFYEYVTDERFKSADKSTETDFIKNLSLHIANADAYKGQIDKARVYFYGTYYAAQLIAAPSNYCNPVS
LSNAAVELAQKVNLECKILDVKELEELKMGAYLSVGKGSMYPNKFIHLTYKGAQTGASQNEKKKIALIGKGITFDSGGYN
LKAAPGSMIDLMKFDMSGCAAVLGCAYCIGTIKPDNVEVHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRL
TLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNDQLINKILSSSKTSNEPVWWLPIINEYRSSLNSKYADL
NNISSSVKASSVVASLFLKEFIENTPWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLNDAV

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_118180

General Sub-Cellular Localisation Links