ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_117880 (RON2)

hypothetical protein, conserved, a gene from Plasmodium vivax

Compiled localisation
rhoptry neck during late schizont

Who localised this protein by microscopy?

Arevalo-Pinzon, G., Curtidor, H., Patino, L. C., Patarroyo, M. A.
PvRON2, a new Plasmodium vivax rhoptry neck antigen. (2011, Malar J) PubMed / full text
   more detail about this publication

rhoptry neck during late schizont
  • "PvRON2 is expressed in late schizonts and localized in rhoptry necks similar to what has been reported for PfRON2, which suggests its participation during target cell invasion."
  • Microscopy type: Fixed light
  • Microscopy method: polyclonal antibody
  • Strain: VCG-1
  • Gene model mapping comments: taken directly from publication, genbank HQ825321 not yet released
  • Localisation record: rhoptry neck during late schizont
  • Other genes localised in this publication: apical merozoite antigen 1, A common gene for all genes not assigned to a gene model

Orthology

OrthoMCL

Part of OrthoMCL group OG4_27374

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PVX_117880 hypothetical protein, conserved
MLKIIFLILLIFARIDSISTREAKGSVRDGKQYVKTKSPTYTPQKKTKVIFYMPGQEQEEEEDDNDPNGSKKNGKSDTGA
NKGTHMGSKTDAGNSPSGLNKGSGVGSGSRPASNNYKGNAGGGINIDMSPHGDNSNKGQQGNAGLNKNQEDTLRDEYEKI
RKQEEEEEERINNQRRADMKRAQRGKNKFGDDKGVQDSLPHTKYELSNPQAGPTNPNAKNRGTGVYDEFGNGPYNLVGKQ
SGGLTPTAPPYEHYGEHGAEGKGYGPYGGAEGKGYGPYGGSDGKGYGTYGGADGKGYGPYGGSDGKGYGPYGGSDGKGYG
PYGGSDGKGYGPYGGADRKGYGPDGTAGSAYHGGYDDGTNPTYRSHLNVNLRDGKGDHDGKNGMEGYPNYFKKHFRPGDA
KGAGTDGNESGTYVVAPGEGGYGKNKGTGADGQNGTEAGGQNGSGTDAQNGSGPHGHSGVGPTTYGVDFGKSGGGRGNGG
GPGEEGENKTNPSYDGGYEKNSGPEKHGENGTPYYVEHPDENDGSGTTTYGLDHGKNGGTQGGHGQDGLGEGGHGQDGHG
QGGYGQGGYGKGGHGEGGYGNGGHGEGGYGNGGHGEGGYGNGGPGEGGYGNGGHGEGGYGQGGHGHGGHGQGGYGQSGHG
QGGYGHGGYGQNHPGSANGAGTHPMHSNGRSSVPSLEYIHGLRPVNAGDGQGVYGGNGINNPLVYHVQHGVNIPNSNSDK
KASDHTPDEDEDTYGRTRNKRYMHRNPGEKYKGSNSPHDSNDDSGDTEYELNEGDVKRLTPKNKKGATTEEVDTYPYGKK
TNGSEFPRMNGSETGHYGYNNTGSGGHNDENGYTPIIVKYDNTHAKNRANEIEENLNKGEYSRIKMAKGKKGQKSGGYES
DGEDSDVDSSNVFYVDNGQDMLIKEKMSRSEGPDEMSEEGLNVKYKAQRGPVNYHFSNYMNLDKRNTLSSNEIELQKMIG
PKFSEEVNKYCRLNEPSSKKGEFLNVSFEYSRALEELRSEMINELQKRKAVGSNYYNNILNAIYTSMNRKNANFGRDAYE
DKSFISEANSFRNEEMQPLSAKYNKILRQYLCHVFVGNPGVNQLERLYFHNLALGELIEPIRRKYNKLASSSVGLNYEIY
IASSSNIYLMGHLLMLSLAYLSYNSYFVQGLKPFYSLETMLMANSDYSFFMYNEVCNVYYHPKGTFNKDITFIPIESRPG
RHSTYVGERKVTCDLLELILNAYTLINVHEIQKVFNTSEAYGYENSISFGHNAVRIFSQVCPRDDAKNTFGCDFEKSTLY
NSKVLKMDEGDKENQRSLKRAFDMLRTFAEIESTSHLGDPSPNYISLIFEQNLYTDFYKYLFWYDNRELINVQIRNAGRR
KKGKKVKFVYDEFVKRGKQLKDKLIKIDAKYNARSKALLVFYALVDKYANIFRKSENVRKFFLNDVSSIRHHLYLNSVLT
KSPKSNLDSMKKTLEELQSLTNAPLKFIVRGNNLKFLNNVAKFENLFYVNLFIMSSLSRKDPVKSYYSEKKKMLTATRAE
KFATSTSALIPHKLRKLVVTMKKGLLKKKLLTALAKMKLLQHIPANLLENILTTIRFTTHTIATREIIQNAKYMPKNLTF
YQNRNVELAKQVFADGGFAKYADNLMSTWFTKGFEEFKREKIEKQKMEYSIEKELKEASNNDISASEEITEQEKLQQEQN
ELNEEKERQRQENKLIFNQNDKWDQYINKEFAKALGIWLELSDNAYNKDSFIYRVVEDSKYLLESNIEDNIMFSRTVKPT
KQTAFRKFFKKIISLGNMLLRKPSFKVEHAIWFGATINMKKAMMLLEKVAELHKLLRNEDESWLINEAFIEIVDHVVLIS
SEKRLREPFSVARNPGMVAINPAYAQLNNEERMKELQNSMCADHCSALWKTISTFALQHLKNPESLHSYESKFSKNSFGN
KIDDQNFVNNFKMILGGDAVLHYFDVLLPKSMKKELKAMKNGVSLSSAFSLKLTKIIFSELQLPYLSQMFYTQAPYFGHF
IGKWQKEREKSRMKEILGFMTLGTLSAYTILSAMDISQHATDIGMGPATSCYTSTIPPPKQVCIQQAVKATLTSSTQACM
KSVFSVGLFASIGPYLFAPMAGLAVWNVLKSEFKVLQRVDMALKSVFKNMWRKFLSIKGIRKLKYIFKRRKTMKKKIIEK
AEHKMLEMKNNPEMAKNHKLAVQKIHKHASGSYHYISYARIQV

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_117880

General Sub-Cellular Localisation Links