ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_111175 (Pvs25, Pvs28)

ookinete surface protein Pvs25, a gene from Plasmodium vivax

Compiled localisation
intracellular during zygote
ookinete surface

Who localised this protein by microscopy?

Hisaeda, H., Stowers, A. W., Tsuboi, T., Collins, W. E., Sattabongkot, J. S., Suwanabun, N., Torii, M., Kaslow, D. C.
Antibodies to malaria vaccine candidates Pvs25 and Pvs28 completely block the ability of Plasmodium vivax to infect mosquitoes. (2000 Dec, Infect Immun) PubMed / full text
   more detail about this publication

intracellular during zygote, ookinete surface
  • "Furthermore, IFA revealed that both anti-Pvs25 and anti-Pvs28 antisera stained the surface of mature ookinetes...The results of IFA (Fig. 5B) show that anti-Pvs25 serum stained intracellular regions of zygotes and anti-Pvs28 stained the surface of ookinetes"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody
  • Strain:
  • Gene model mapping comments: Blast from EU024471, annotation matches
  • Localisation record: intracellular during zygote
  • Comment: Couldn't figure out how the stained from methods section
  • Other genes localised in this publication: -
  • "Furthermore, IFA revealed that both anti-Pvs25 and anti-Pvs28 antisera stained the surface of mature ookinetes...The results of IFA (Fig. 5B) show that anti-Pvs25 serum stained intracellular regions of zygotes and anti-Pvs28 stained the surface of ookinetes"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody
  • Strain:
  • Gene model mapping comments: Annotation only
  • Localisation record: ookinete surface
  • Comment: Couldn't figure out how the stained from methods section
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_33730

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PCHAS_051510 25 kDa ookinete surface antigen precursor, putative
  • PKH_061530 Ookinete surface protein Pvs25, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PVX_111175 ookinete surface protein Pvs25
MNSYYSLFVFFLVQIALKYSKAAVTVDTICKNGQLVQMSNHFKCMCNEGLVHLSENTCEEKNECKKETLGKACGEFGQCI
ENPDPAQVNMYKCGCIEGYTLKEDTCVLDVCQYKNCGESGECIVEYLSEIQSAGCSCAIGKVPNPEDEKKCTKTGETACQ
LKCNTDNEVCKNVEGVYKCQCMEGFTFDKEKNVCLSYSVFNILNYSLFFIILLVLSYVI

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_111175

General Sub-Cellular Localisation Links