ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_110810 (DBP)

Duffy receptor precursor, a gene from Plasmodium vivax

Compiled localisation
microneme during mature schizont

Who localised this protein by microscopy?

Black, C. G., Barnwell, J. W., Huber, C. S., Galinski, M. R., Coppel, R. L.
The Plasmodium vivax homologues of merozoite surface proteins 4 and 5 from Plasmodium falciparum are expressed at different locations in the merozoite. (2002 Apr 9, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during mature schizont
  • "In an attempt at finer discrimination of a potential organellar location, we performed two-color IFA using rabbit anti-PvMSP5, monoclonal antibody (mAb) 1C10 against the P. vivax duffy binding protein (PvDBP) (Fig. 4C), which is located in micronemes, and mAb 4E1 ( Fig. 4F), which recognizes a 105 kDa antigen in the paired rhoptry organelles."
  • Microscopy type: Light
  • Microscopy method: monoclonal antibody (mAb1C10)
  • Strain:
  • Gene model mapping comments: Annotation only
  • Localisation record: microneme during mature schizont
  • Comment: strain information not found
  • Other genes localised in this publication: merozoite surface protein 4, putative, merozoite surface protein 5

Orthology

OrthoMCL

Part of OrthoMCL group OG4_31615

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PVX_110810 Duffy receptor precursor
MKGKNRSLFVLLVLLLLHKVNNVLLERTIETLLECKNEYVKGENGYKLAKGHHCVEEDNLERWLQGTNERRSEENIKYKY
GVTELKIKYAQMNGKRSSRILKESIYGAHNFGGNSYMEGKDGGDKTGEEKDGEHKTDSKTDNGKGANNLVMLDYETSSNG
QPAGTLDNVLEFVTGHEGNSRKNSSNGGNPYDIDHKKTISSAIINHAFLQNTVMKNCNYKRKRRERDWDCNTKKDVCIPD
RRYQLCMKELTNLVNNTDTNFHRDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDME
GIGYSKVVENNLRSIFGTDEKAQQRRKQWWNESKAQIWTAMMYSVKKRLKGNFIWICKLNVAVNIEPQIYRWIREWGRDY
VSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKVQTAGIVTPYDILKQ
ELDEFNEVAFENEINKRDGAYIELCVCSVEEAKKNTQEVVTNVDNAAKSQATNSNPISQPVDSSKAEKVPGDSTHGNVNS
GQDSSTTGKAVTGDGQNGNQTPAESDVQRSDIAESVSAKNVDPQKSVSKRSDDTASVTGIAEAGKENLGASNSRPSESTV
EANSPGDDTVNSASIPVVSGENPLVTPYNGLRHSKDNSDSDGPAESMANPDSNSKGETGKGQDNDMAKATKDSSNSSDGT
SSATGDTTDAVDREINKGVPEDRDKTVGSKDGGGEDNSANKDAATVVGEDRIRENSAGGSTNDRSKNDTEKNGASTPDSK
QSEDATALSKTESLESTESGDRTTNDTTNSLENKNGGKEKDLQKHDFKSNDTPNEEPNSDQTTDAEGHDRDSIKNDKAER
RKHMNKDTFTKNTNSHHLNSNNNLSNGKLDIKEYKYRDVKATREDIILMSSVRKCNNNISLEYCNSVEDKISSNTCSREK
SKNLCCSISDFCLNYFDVYSYEYLSCMKKEFEDPSYKCFTKGGFKDKTYFAAAGALLILLLLIASRKMIKNDSEEATFNE
FEEYCDNIHRIPLMPNNIEHMQPSTPLDYS

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_110810

General Sub-Cellular Localisation Links