ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_095475 (CTRP)

CTRP adhesive protein (invasive stage), putative, a gene from Plasmodium vivax

Compiled localisation
apical during ookinete

Who localised this protein by microscopy?

Kaneko, O., Templeton, T. J., Iriko, H., Tachibana, M., Otsuki, H., Takeo, S., Sattabongkot, J., Torii, M., Tsuboi, T.
The Plasmodium vivax homolog of the ookinete adhesive micronemal protein, CTRP. (2006 Sep, Parasitol Int) PubMed / full text
   more detail about this publication

apical during ookinete

Orthology

OrthoMCL

Part of OrthoMCL group OG4_20693

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFC0640w CSP and TRAP-related protein
  • PCHAS_041380 circumsporozoite- and TRAP-related protein, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PVX_095475 CTRP adhesive protein (invasive stage), putative
MNKSFLLIASYFCLVVHLGTVIAQRSQDESSHQYVHLAGNGRSVKKATLDKDIPEGRILTKKQSFLQHNTLAVGSLAAGS
LAAGSLAAGSPPPPCVGDDDCFCQNFYDLTLIIDESGSIGIKNWEKHVIPFTDKIIKDLHIGENEVHAGILLFSNFIRDY
VTFDEDESYKKDKLLKKVDQLKKKYAAGAGTKIVSALDYALEKYTHHKKGRPNAPKVTILFTDGNDTSSSSSTKLLDMGL
TYRKKNVKLLVLGVAAAKDVNLRAIAGCGDKNVPCPYAMKAEWDTINDITKKLTNKICHTEEEDEEITTTTTPPPPQQNP
CQGDDCFCEDYYDLTLILDESGSITLNKWKIDVVPFAEKVVSNLNISKDKIHVGIMRFAIKVKEDVSYGQETRYDKSALI
NVVKELRDKYGSGQGTRLVDALEHSLTNFTRHPNNRPNAPKVTILFTDGNENYRRPSDVRNIGLKYRKENVRLIVVGVYK
ATIKSLKMLAGCGENEHCPQVIKCDWDQLTSITEVITDKICDIDAGELPGGEEKPGGEEKPGSSDKPGGEEKPGSSEKPD
GTEKPGDADKPNGSDKPNGSDKPNEQHPPCADWDDCYCKHFYDLTLILDESASIGNFRWSHEVVPFATEIVKSLHVGYSA
VHVGLLLFADSRRDVVRFSDATRYDKSFLLQKIESLKGDYRNGKKTFIVQALVYALASYTKGSSRVNAPKVTMLFTDGND
SRESDERLYQTGLLYRREKVKLLVLGVSMADENKLRLLVGCTRNANCPFVIKAEWGQLPSVSNEFVRRICSSGPIIPPED
GSSSPPLPPPEVANPTDPEPVVPPPQCQGDECLCQSMYDLTLILDESASIGHSNWKKQVYPFVEKIVSNLEVSESKVHVG
IMLFAKHMRDFVRFSEKESYEKDSLMRKVPELKGTYKAGSHTYIVESLEYGLQHYTKGASSRADVPKVTILFTDGNNSKS
GDEILSNVNSLYKKENVKLLVVGVGAASMPKLRLLGGCHKTEGDCPFAIKTEWDSLKDISQGMVDKICNTDTEINPPPPP
PPSSGGAEVATPSCTGDECFCRDYFDLTFIGAPSTKKNSRRKDELTKYVTKIVNTFNVGEKHVHVSLSLHLGAKTVNTDF
DSAVARDKKELLSALEVMSTEWANLGRKTNIAEALTVGLKQSFSTGHREDAPKVALLLTDSNNDVSEEGMLQSVSKQYAD
RKVKLLVVGIGKLPEELLFIAAGCALSGSGGDPPRYGQTCPTVFISSRFSYINSVEKFLGRNVCDGGGGGDGGAQQVEPP
LPPPSLPCQDDESCTECDDDACNNDPTCKKIFDIAIVIDQSRGITNDQWKKYVRPFSTYVIKSNYLAKNRTHVTLVKMGR
TAKVLWKLGRKASYRKNQMIKKVNRMVKTSTSRKDIARNLKHLREEVFTKKTSSSSSSSPAPDRRKKLIIMLVEGTSHTD
LNELRREVALLKVNNIDLFVYAIDNVDDEEYRILGDCENASSGVCKNAVKVTWDKLLSSEEIHSSYICNQYPADAECAEW
GDWSPCPDSSTSSTCNNLAVSKRERKGPPYTLKEEEYLDDGRHMHGSSCTDLSSIEYRACPVTEECNDVCGDFGEWSQCS
ASCGDGIRTRQRAGAAGRGDAPLAASFQDDQADSCQLFNATEVEACNVQDCDDAEICEEVGEWGEWSACSKACGYSTRSR
TFVILPEDMDEYAHCSTFEKSETEVCSVPACEDEKCFEWEEWTEWSAPCGPRKRAHECEAYYQNKVERDDGSNGVPCTDN
PCGSWSEWSECDRKCNVGMRMRRFISNVTGFVGDDEDLCLEYHNEIETEPCLDLPLCDEGECNDWETWVGCGEEEHPGLR
PATSPRGASTSCHASPRRRILTRKPELLQHRKESTSKFCSDYKLFREEECPVLGGATPCNDALCNEWEDWGECSPTCGTE
SYRVRRRKEPLELIPPSEDMDGKMGLTCEQQNVRIEEREACSVPACAPPSGGGGSGSGSGSGNGSDSGGMGTGEKVSLAA
GILGLAALGVGGMIYGYNTLNGGEAPHSSNMEFENVETDGAEVEKSNEDFEVIDANDPMWN

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_095475

General Sub-Cellular Localisation Links