ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_092275 (AMA1)

apical merozoite antigen 1, a gene from Plasmodium vivax

Compiled localisation
microneme during schizont

Who localised this protein by microscopy?

Arevalo-Pinzon, G., Curtidor, H., Patino, L. C., Patarroyo, M. A.
PvRON2, a new Plasmodium vivax rhoptry neck antigen. (2011, Malar J) PubMed / full text
   more detail about this publication

microneme during schizont
  • "It was found that there was no co-localization between the PvAMA-1 protein (microneme marker) and PvRON2 (Figure 3C), suggesting that PvRON2 is not present in micronemes."
  • Microscopy type: Fixed light
  • Microscopy method: polyclonal antibody
  • Strain: VCG-1
  • Gene model mapping comments: blast from antigen RNQKPSRLTRSANNVLLE, annotation matches
  • Localisation record: microneme during schizont
  • Other genes localised in this publication: hypothetical protein, conserved, A common gene for all genes not assigned to a gene model

Orthology

OrthoMCL

Part of OrthoMCL group OG4_27887

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PVX_092275 apical merozoite antigen 1
MNKIYYIIFLSAQCLVHIGKCGRNQKPSRLTRSANNVLLEKGPTVERSTRMSNPWKAFMEKYDIERTHSSGVRVDLGEDA
EVENAKYRIPAGRCPVFGKGIVIENSDVSFLRPVATGDQKLKDGGFAFPNANDHISPMTLANLKERYKDNVEMMKLNDIA
LCRTHAASFVMAGDQNSSYRHPAVYDEKEKTCHMLYLSAQENMGPRYCSPDAQNRDAVFCFKPDKNESFENLVYLSKNVR
NDWDKKCPRKNLGNAKFGLWVDGNCEEIPYVKEVEAEDLRECNRIVFGASASDQPTQYEEEMTDYQKIQQGFRQNNREMI
KSAFLPVGAFNSDNFKSKGRGFNWANFDSVKKKCYIFNTKPTCLINDKNFIATTALSHPQEVDLEFPCSIYKDEIEREIK
KQSRNMNLYSVDGERIVLPRIFISNDKESIKCPCEPERISNSTCNFYVCNCVEKRAEIKENNQVVIKEEFRDYYENGEEK
SNKQMLLIIIGITGGVCVVALASMAYFRKKANNDKYDKMDQAEGYGKPTTRKDEMLDPEASFWGEDKRASHTTPVLMEKP
YY

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_092275

General Sub-Cellular Localisation Links