ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_091405 (VX-4)

vivapain-2, a gene from Plasmodium vivax

Compiled localisation
cytoplasm and food vacuole during erythrocytic

Who localised this protein by microscopy?

Na, B. K., Bae, Y. A., Zo, Y. G., Choe, Y., Kim, S. H., Desai, P. V., Avery, M. A., Craik, C. S., Kim, T. S., Rosenthal, P. J., Kong, Y.
Biochemical properties of a novel cysteine protease of Plasmodium vivax, vivapain-4. (2010, PLoS Negl Trop Dis) PubMed / full text
   more detail about this publication

cytoplasm and food vacuole during erythrocytic
  • "VX-4 was localized in the food vacuoles and cytoplasm of the erythrocytic stage of P. vivax. "
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody
  • Strain:
  • Gene model mapping comments: blast from XP_001615272, annotation doesn't match, taken directly from publication
  • Localisation record: food vacuole and cytoplasm during erythrocytic
  • Comment: strain information not found
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10073

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PVX_091405 vivapain-2
MEYHMEYSNDKSHKPEKELFVEKSFGGRNGKGRKSLLVVLSVSAMCLLAGSAFYFTRTGKGNDGPLYGNALDESSSDDFI
ITSLLKSPGGKKFIVSKLQELIASYDEDVNSAKASPSKEGPTGAHSTSVATVSRQKQGNLKVPKKIEINFADSRFLMINL
EKVNAFYLFMKEHGKKYKTEEEMQQRYLAFTENLARINSHNSKANILYKKGTNQYSDISFEEFRKTMLTLRFDLKKKLAN
SPYVSNYDDVLKKYKPADAVVDNEKYDWREHNAVSEIKNQNLCGSCWAFGAVGAVESQYAIRKNQHVLISEQELVDCSDK
NFGCFGGLASLAFDDMIDLGYLCSESDYPYVGFKPRKCEIKKCKEKYTIKSYVKIPEEKYKEAIQFLGPLTLGLTVNDDF
YDYKEGIFSSECTEEPNHEVMIVGYGVEEMFNSESNASEKHYYYIIKNSWGENWGEKGFMRIETDELGLQKTNNMTEAYV
PLLD

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_091405

General Sub-Cellular Localisation Links