ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_091040 ()

hypothetical protein, conserved, a gene from Plasmodium vivax

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11313

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PVX_091040 hypothetical protein, conserved
MQSDIIVSKDLPDYSKGRMNGVMNISAYSGSGAPGCREQTNEGSTSAIYEEGKALNYDRASSATFKDDLESSSDWNSSPA
ELSTSAVAAAGAAAATAATAATPPSDERKVSNSIDTAHVATISAANKNYDHVQNSNRANGNCEMKDSNDVRASDETITHS
VDDVGSLKKTSTLPSLEAIAASEMVPAAVEKNRASCTDIGAISPSDAKERGLAKEEFGGEEAANPGANCPAVNISSVKFP
SVNCPTVNINCPSANASADAASDSKSSDAPVRYSESGAGDRKDFSGGYASLRVGSVKGTDDACADVPKLNATIESDIKMS
NASVCANLVGGGEGHLSEAAHCKEGTPKDAGLNNCSDKAAGCQGAARKEGGQFESGLAQEGSIGHSGGGHSASAGGSGNA
SGGGGNSGGSNTGGSSNNGGNNNGGSNTGGGSNTGGSNSGEDGEKNDGDKHRKNGHQDAGSGEGSGSLENPNEGKGGEDS
RKNGNGGDRGDDRSDDRSHGQKKDEHSGKAADGANRSSNPSESGKKNKSSNSVEGKSGSGKGHSMSSSKPSSNSVSTPVS
SLNADAPEFVPSTKGMPGNLSFNNLMWNHYYQDMSNGAFGGVAANGMINNLAAQGSNSMMSPPNPLLSPLGGMGHGPGDL
LNLANSSHMSASNGGISLSIPNNAGVMLPQVSNLSNIDARNNEKGNNLPSGGGGVPASTGGSVNNHAGNKSVSSSKLGSS
SNNNANSTGHDNNVATASSNMMHGSGAAAVVGKGGANSSGTDSTFLNQSGMLPGMKNMRANNFMNGSESSGPPPFHTIDP
HNAGHHQAFQPNGSMMHPHNFYVNHPYLMNNHPHAHPHHPHHPHPNALPGPPQSLFTPMSYANSLGTANVHHEFPFPQPP
PSVYGSFGNSTNLIGSNTTTALSSSKNGTMGMNPYSFMSCGLPAHPPPPQLQHNAPLNLSAPLEAHFISGSTGNAAPPMK
IPYNHVAQPNRRNMFNHFNMANMHAGGTTLTDGTFEHGVSSNNSNMSNVIGAAAAAAAGITYGYGNFGATHNVSGSSSDN
LLPTGDNAGSNNSGSAGAANAGANSSANNGANNNSGSSSAGGMQLTPALGSNMGMSANGSVMCINGPLHMTNVSATNVTP
LSHHHMNQMNNVMAAGAAAGGAAMGTMTAGGMHMGTMQMNHNMMVNTMEGVGAPIGAAAVTKQQKRSSTYGERNANGGGG
GGSNNNSSGKAAGSHREGKGGVKGSNSNSNSVMASSAAAGAAAGGGSGGGATGLTSYGKQDSKKGSKYGGSGVGSGAGGN
NMNVNFNAHSGNNAGHAMGSGSKNMYASGKGAKQEALYGRDENGNATTTTPGATASPASNGYFGKGSTGNNNNSNALLST
GPGSNNMSGAVHQKESDLSGGLNESLDDISANKHMQYDGSTNEGGKGSFKGKAGAYSSLGNSGNARSKGNNSSSSNNMAS
AHAAVTGSNNEAIAAGEKRFFNKHEKGKDDYKGGKSYGSNKMGEEKGSYNHIGGGASAGAAASSKKDASKDNIKGGTKNG
EVHVKKQCNNDLLGHSNSGNMANQQQPLGSSNKQQGSYTSGGKYQSSAEKRVGHMRNAEGGKGGSEKKLKNEDDKKFKEK
DGNMLAGPGGAAKGASAKAGSTPMGGSGSNFAVSNMNDQGLLPNSDSMNGKNLPGVGTPDGVNGPYPNSNYNGSAVSNNK
SANYGNAKNAKSYDKKNTEFSSWVKIAKMNPNKKKGDKGSLNGQQEGGSNHAPVGGGVAGSSSITNATLKHHDGGSAEKG
SSGHHGMGGAAGVGDPSNNSFNSAKGRGHNNEGAAGYSKGGSSTINGALHMGHENGPPSNAQSSRDGKKRKDEEEQRAER
HKGMINKDMTGMNNNSSVVHYGKSSKKGSEDKSDNMMSSNAKNKKLTSYGSGKNSSYHEKESVKERGGKMKYDNGGSAGV
KKMEMVNERKGGAVGSGGAGGSAVGGSGGGASGGGNVTNTSGSIYSSHRQREKMKIQNVEIKQINEKVMKRRSEDRKEAT
EKKGAGAQEHVKRVGGTGSSSKHTEREDQSDAVKKQGRDHPYEGRSKAHCNGDVKNAEYEQELDDHEGAVAAGGARDDGV
KKSHLASTWTSGVRGESGRNKDEAYQNDSQNENNAHAGGSSSIHDNNPQVRKGENAHMNKEGSYKYGAGPSEYHGHAPNQ
SVSGSVNANVSVNAAANAHDNRSVSTYSNSKNSVWDGKISFAEMAKRKPKKETKEPRGGDSKNGKSESSHNDRKNAHHGS
NHKGDKPSKRRDQRGKRYGSNSTIRDKPSGTTVHSRGGESNDKKNHISGNNNHGSNSTSRDSARGGASEMRKRNDLKEHA
KKGYDGGSAAPNMRDSRRRGGVAADAPLKGYHNRREEKDMMDHVMADQNGTLSEAEGSDDAYHKRRGGEVKSGLRDGLME
EEKGEVDEVSRENATVEEEEAVEVLEAVEVVEADEAVEAIEGDGHVEARPGAAPKPDSLQMEREGPKKMYHGGAERMPNP
VAHEDTEDAEIVEGNKIVGSNNNVTDDSGSSSIAKFSPPTDADVSTHRTDEWSEKGAKRHGMKEGSAKLFPDGLSKYEKM
KLEDAESDLQAVACEAERHGISIGGAKKAHVVSSAADHFAEMNAQGGQSNRLSALMNGKVLEPSGDAKYVRGGSSSRAVK
KKGGLKGASGVSGERGVEGRADGRADGAGTGKGLLEEETKTAITIDTEESVKVAKLSNEDLAAAKSEKSKAGGKKKYGLF
SDIKKWAKGKLADGAGAADGAPQEEKKAMGGGSKDNQNDAGVGSAGDMGDVVKKADDVVRKADDVVRKADDVLPTVDVKM
GGMSNADAVPASLNDEKETPAGGEKEEISGSNVAPAKVETKSKADGLLDSLEKKADELEVEKANEKAAVQNEKDHEEAER
EKERQRMKQMKLERMGKSKIYSKIDLLEIFVGNKWNTGEERFNFMLSYNPDVDCHKMGSAMMGSCNINHMDMNGMHAHNH
MGGGHAHEGKNSMYSKRYMNAGGSGGGHGSGGSGGMNNNYMGGNNNHGNNSGKQFGMNSGGGGKNNDDVWRYAQGGKSGM
NNNGHFANGGANMNFGDMNHSNSGNIAGSGGKGGMGSGGGSMDAHNAGSGGLGKMGQANLEWRKNDGDKLKGFFDSTRAV
ESPDAWRHNNNHSGGGSSGGGGKTVAENSWLLKQNQLKADKYTCMMRKLRGILNKLTFEKFDLLYEQIILVGITKLEEII
GLMKLVFEKAVTQHHFVQMYVQLCKKLNVHFQNMKLEDDTTVQFKKILINQCQDSFENNLKPIEYPSNLTNEEERFEFEQ
MHKNKVRGNMLFVGELVKSGIISIPIVFVCIKQLLEKRESYISAKNDTNEGNLHLEALCMFLNTVGEILDTHEKANQEKV
KELYNTLHALINDESITFRVRCLIKDVIDNRNEKWNKKFAHKLEGPTTLSVLHDKILKESIDQSSRSFNSSSNNMGNYHD
SKMNSSLSNMRNNLLRNVNFNMNSGNSGGGANVGGGLGGSSNNSGNSNAGFGMMNMRNLGGGMKNMDPNKNMKKLSLNLM
KAKNASASKMMGDDMMKGAGGVSAVSGVSGACQDGANAGGSFFDMMSKNHLAFKNSHQAFMNNEGASGGNAAGGAGSSGG
GAFFSSLNSRFPAKEKSGSSGSPSEGKFFMRNFNLKKSPVGSGAVGSGPTGGGAIGSAANSAANDAAGKTEEQPNDAPMT
ATASPSTESVSGSGSPNDGAEKGAPTAGSPSAGANGASDDYAFTEEYLPKVNEILELSTITGSDEWETLTKKIENLNVPP
KFNEKLQKHILKLTLKKYACNKNVEKSAEYFDWLISIVLLNKIDLESFKPCWKAFMLQDDENGYECTKEDYPLLPFLAKN
FIKAIELHDTNHLLYDAATVDEMKSVI

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_091040

General Sub-Cellular Localisation Links