ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_090935 (H2B)

histone 2B, a gene from Plasmodium vivax

Compiled localisation
nucleus during extracellular merozoite and ring and schizont and trophozoite

Who localised this protein by microscopy?

Rawat, D. S., Sharma, I., Jalah, R., Lomash, S., Kothekar, V., Pasha, S. T., Sharma, Y. D.
Identification, expression, modeled structure and serological characterization of Plasmodium vivax histone 2B. (2004 Aug 4, Gene) PubMed / full text
   more detail about this publication

nucleus during extracellular merozoite and ring and schizont and trophozoite
  • "The expressed PvH2B protein showed DNA-binding properties on the South-Western analysis and the confocal microscopy localized it in the parasite nucleus"
  • Microscopy type: light
  • Microscopy method: polyclonal antibody
  • Strain: untyped indian strain
  • Gene model mapping comments: blast from Y17725
  • Localisation record: nuclear during RBC stages
  • Comment: histone 2B
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10044

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PVX_090935 histone 2B
MVSKKPAKAKKATTGATDGKKKRKKSRYDSYGLYIFKVLKQVHPDTGISRKSMNIMNSFLVDTFEKIATEASRLCKYTRR
DTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTSK

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_090935

General Sub-Cellular Localisation Links