ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_090930 (H4K5Ac)

histone H4, putative, a gene from Plasmodium vivax

Compiled localisation
nucleus

Who localised this protein by microscopy?

Luah, Y. H., Chaal, B. K., Ong, E. Z., Bozdech, Z.
A moonlighting function of Plasmodium falciparum histone 3, mono-methylated at lysine 9? (2010, PLoS One) PubMed / full text
   more detail about this publication

nucleus

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10043

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>PVX_090930 histone H4, putative
MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEIRGVLKVFLENVIKDSIMYTEHAKRK
TVTAMDIVYSLKRQGRTLYGFGG

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_090930

General Sub-Cellular Localisation Links