ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_090265 (TRAg)

tryptophan-rich antigen (Pv-fam-a), a gene from Plasmodium vivax

Compiled localisation
cytoplasm and host cell cytoplasm during extracellular merozoite and ring and schizont and trophozoite

Who localised this protein by microscopy?

Jalah, R., Sarin, R., Sud, N., Alam, M. T., Parikh, N., Das, T. K., Sharma, Y. D.
Identification, expression, localization and serological characterization of a tryptophan-rich antigen from the human malaria parasite Plasmodium vivax. (2005 Aug, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

cytoplasm and host cell cytoplasm during extracellular merozoite and ring and schizont and trophozoite
  • "It is localized in the parasite cytoplasm as well as in the cytoplasm of the parasitized erythrocyte"
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody
  • Strain: untyped indian strain
  • Gene model mapping comments: blast from Y18842
  • Localisation record: cytoplasm during all RBC stages, erythrocyte cytoplasm during RBC stages
  • Comment: Tryptophan-Rich Antigen, Immunogold particles were also seen associated with the parasitophorous vacuolar membrane, caveola vesicle complex (CVC) and membrane of the parasitized erythrocyte
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_53562

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PVX_090265 tryptophan-rich antigen (Pv-fam-a)
MEAARGVSGLVPSSNSLQEITLRYKDKLLNMDKEQMILTLGVTMIAITSAVAFGVLATHGDINDFLGVESDEESEKKKEI
VEKSEEWKRKEWSNWLKKLEQDWKVFNEKLQNEKKTFLEEKEEDWNTWIKSVEKKWTHFNPNMDKEFHTNMMRRSINWTE
SQWREWIQTEGRLYLDIEWKKWFFENQSRLDELIVKKWIQWKKDKIINWLMSDWKRAEQEHWEEFEEKSWSSKFFQIFEK
RNYEDFKDRVSDEWEDWFEWVKRKDNIFITNVLDQWIKWKEEKNLLYNNWADAFVTNWINKKQWVVWVNERRNLAAKAKA
ALNKKK

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_090265

General Sub-Cellular Localisation Links