ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_090075 (Pv34)

hypothetical protein, conserved, a gene from Plasmodium vivax

Compiled localisation
rhoptry during schizont

Who localised this protein by microscopy?

Mongui, A., Angel, D. I., Gallego, G., Reyes, C., Martinez, P., Guhl, F., Patarroyo, M. A.
Characterization and antigenicity of the promising vaccine candidate Plasmodium vivax 34kDa rhoptry antigen (Pv34). (2009 Dec 11, Vaccine) PubMed / full text
   more detail about this publication

rhoptry during schizont
  • "(C) Indirect immunofluorescence assay using rabbit's hyperimmune serum against the two Pv34 synthetic peptides showing immunolabeling of a fixed P. vivax schizont. The punctated fluorescence pattern observed is characteristic of rhoptry proteins."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody to epitopes EVKAPKDDGGKEQDTLAGNK and VQNEIKNNEKLNKEKKSYDE
  • Strain: VCG-1
  • Gene model mapping comments: blast from FJ971590, but genbank does not appear to exist yet, taken directly from publication, orthomcl from PFD0955w
  • Localisation record: rhoptries during schizont
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_54213

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PVX_090075 hypothetical protein, conserved
MLYDYLFTPEVKAPKDDGGKEQDTLAGNKQMSYKTSEVQIKHHEEVHTGGMENGDHRKELKEHMDQLKMLHKSLKSKDRN
TYGQVKPSGGESVHSNDGALGDTHTGGDQTSEESLAKYVQNEIKNNEKLNKEKKSYDEINLLEDNSKKLQNDIHTWLQSV
KNITEKTSKLKDIKTQLLNNIASLNETLTEEIENINEIKKLQKEQNEIFSENWLYFLPSTSDSLASEGRDGSFQQEGRSA
S

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_090075

General Sub-Cellular Localisation Links