ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_086930 (Clag7)

cytoadherence linked asexual protein (CLAG), putative, a gene from Plasmodium vivax

Compiled localisation
apical during schizont

Who localised this protein by microscopy?

Moreno-Perez, D. A., Mongui, A., Soler, L. N., Sanchez-Ladino, M., Patarroyo, M. A.
Identifying and characterizing a member of the RhopH1/Clag family in Plasmodium vivax. (2011 Jul 15, Gene) PubMed / full text
   more detail about this publication

apical during schizont
  • "Apical expression of PvClag7 in segmented schizonts evaluated by fluorescence microscopy using 100× oil immersion objective"
  • Microscopy type: Fixed light
  • Microscopy method: polyclonal antibody to peptide
  • Strain: VCG-1
  • Gene model mapping comments: taken directly from publication, genbank HQ728488 not yet released?
  • Localisation record: apical during schizont
  • Other genes localised in this publication: A common gene for all genes not assigned to a gene model

Orthology

OrthoMCL

Part of OrthoMCL group OG4_19663

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • MAL7P1.229 cytoadherence linked asexual protein
  • PFC0120w cytoadherence linked asexual protein 3.1
  • PBANKA_083630 cytoadherence linked asexual protein 9
  • PBANKA_140060 cytoadherence linked asexual protein, putative
  • PY02932 PyRhopH1A-related
  • PY04666 PyRhopH1A-related
  • PY06117 PyRhopHA1 paralog
  • PVX_094265 cytoadherence-linked asexual protein (CLAG), putative
  • PVX_121885 cytoadherence linked asexual protein, CLAG, putative
  • PCHAS_083660 cytoadherence linked asexual protein 9, putative
  • PCHAS_140250 cytoadherence linked asexual protein, putative
  • PCHAS_146810 cytoadherence linked asexual protein, putative
  • PKH_073370 cytoadherence linked asexual protein, CLAG, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PVX_086930 cytoadherence linked asexual protein (CLAG), putative
MKIWFIQQTIFYIGITLVRKIACSYKNENIEELKRIIDNAELYANLEKLEYMILQTLEQDKLKLPIVRHDVRRYFDFSKF
KMIPFKAVNHHDREYIVPTVHSEAEDIIKYEHALKTQVAIDYKHELSDLIKKKILIVRTLKIIKIMKIPMNEYKKSFKIS
EALLKLNNLFTNKNDPKNDDEVGTRMMKKRIFGKRGLSGKTVRRRIALYMPIDFQMDIINYNDLLFTYQPNIELMRKLDR
KANYFDIGIFNYLAHKHYNKFFEIGNLKFHNWNSILRFNHSDRYKVLDLLCDESNSYEGDKKRRELYLKNNISSTTEECT
ILEFLVHHINKYQMELFTNDAKLNLNLQMLMENFHLKEKFFDFMCKKDSSGSCCIYDGPKFKEEKQEDMPFVDKHNYTFE
QTKLIFPIKSNPHDIFTNYVNFIKYYNEFNGDQVLYIHLLNLIGLLNGNIGAYVGSLYLPGYYNAIQLAYEDNRPMKDLY
ENLVKCVEMCYSRTKKNKTLAFKISSIFKNKKFDSSKCNICEGTLFYINNQVQDSMSMLQKYNGYTSKVLKVNIVSHLIR
FMNIYEEYNSFLMHDLNWFTFLFLFRMTTYKDIAQYSISNAMYLDLQDEDTQKKTIVTYHWYPSYLKKYITNRTRKNEAV
NLLEELEKMIDKDIIEKMKKCIKFVIHVSSVLQMDFFYYLNETPLGEHHPFGLTMDIEGRFKEWFSSYMYNFPLINYEHP
KGRYNMQKEQKKGKFVAPKYSKWTLHLKKIIEKSFINQFNQKHVRTLFKHFGSYNINNKIMLLRDSYELYLKNFENIYFL
GDIMLLRKFFGATPKSIILRQQIHYFMHNIFGNPLNFYKFGLIYGYTFNKVYLKEIVDALYVIYQMNQAIFTEMSFLQTV
RLLFRKIQYSFFSHRRNDDISMNNIFFFSVRQDYSKLKKEVREEEIHLSMASRFYEKTMYTLFQMMFVTRISKHINKLDR
KFGNASMLGLTMVEEPALQFKYVYYGSMFDSLLNVFFPMFIKKPVVQLKYGKTFVLANMYKLASELFAIYNLNNLSVLCD
YQSMTSANAYVFRKTMKFLDKKFLPLVVAAFFMKISDEIKEANLQGGFWKRYYTNRLEGKKIIPYFVYLTFYTSGNAYLR
NHLFFPNPLGQELSKQTEGLTNAPPKEKPETHRISGVILLGMVHSLSISFFIFTLVRWYAFYDNIIFLLRNTFRVFDRFY
TILERYINSFVKRMYNRFTADVLLKSLRRAYDRAKDEGYYEESMTARISSKLFGQTEGEQTIEPPPVLSEIDIEAVQNNS
SLFYVDNESLFEDLDDDEQFLNQRDIIFYDDNIDKRGIYNFVPVKNTY

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_086930

General Sub-Cellular Localisation Links