ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_085930 (RAP1)

rhoptry-associated protein 1, putative, a gene from Plasmodium vivax

Compiled localisation
rhoptry during mature schizont

Who localised this protein by microscopy?

Perez-Leal, O., Mongui, A., Cortes, J., Yepes, G., Leiton, J., Patarroyo, M. A.
The Plasmodium vivax rhoptry-associated protein 1. (2006 Mar 24, Biochem Biophys Res Commun) PubMed / full text
   more detail about this publication

rhoptry during mature schizont
  • "as observed by microscopy, the immunofluorescence pattern displayed is suggestive of its rhoptry localization"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody
  • Strain: VCG-I
  • Gene model mapping comments: blast from DQ311677
  • Localisation record: rhoptry during mature schizont
  • Comment: Plasmodium vivax Vivax-Colombia-Guaviare I (VCG-I) strain
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_42838

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PVX_085930 rhoptry-associated protein 1, putative
MITCVSSLLVLFYALYQNVSSGIPINGERKIDNHKEPEEFNPDDINSWMRLDDANFLNTWTKNVSDISFVESKASKETGS
ENGDASSTGSGKDSYGDWNFMTNQNEAGKPGKPKSNSGESNASSSDGKSSASAKSGSKSGSKYGGSSYSDYSAYDSGSAS
SVGSREFENEMYEFALQHPMEKLTKEMDILKNDYTKVKEEEGKILDEEHKEIEEKRKEERLKMLAEGDVEKNKGDEEINF
IKHDYTDTRIRGGFTEFLSNLNPFKKEIKPMKKEISLITYIPDKIVNKEKIMRDLGISHKYEPYQQSILYTCPNSVFFFD
SMENLRKELDKNHEKEAITNKILDHNKECLKNFGLFDFELPDNKTKLGNVIGSIGEYHVRLYEIENDLLKYQPSLDYMTL
ADDYKLVKNDVNTLENVNFCLLNPKTLEDFLKKKEIMELMGEDPIAYEEKFTKYMEESINCHLESLIYEDLDSSQDTKIV
LKNVKSKLYLLQNGLTYKSKKLINKLFNEIQKNPEPIFEKLTWIYENMYHLKRDYTFLAFKTVCDKYVSHNSIYTSLQGM
TSYIIEYTRLYGACFKNITIYNAVISGIHEQMKNLMKLMPRSGLLSDVHFEALLHKENKKITRTDYVLNDYDPSVKAYAL
TQVERLPMVSVINSFFEAKKKALSKMLAQMKLDLFTLTNEDLKIPNDKGANSKLTAKLISIYKAEIKKYFKEMRDDYVFL
IKARYKGHYKKNYLLYKRLE

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_085930

General Sub-Cellular Localisation Links