ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_003775 (MSP4)

merozoite surface protein 4, putative, a gene from Plasmodium vivax

Compiled localisation
surface during mature schizont

Who localised this protein by microscopy?

Black, C. G., Barnwell, J. W., Huber, C. S., Galinski, M. R., Coppel, R. L.
The Plasmodium vivax homologues of merozoite surface proteins 4 and 5 from Plasmodium falciparum are expressed at different locations in the merozoite. (2002 Apr 9, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

surface during mature schizont
  • "Indirect IFA analysis of thin smears of mature and segmented P. vivax schizonts localized expression of PvMSP4 to the merozoite surface as was to be expected based on previous results with antibodies to PfMSP4."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody
  • Strain: Plasmodium vivax (Belem
  • Gene model mapping comments: Blast from AF403475, annotation matches
  • Localisation record: surface during mature schizont
  • Comment: strain information not found
  • Other genes localised in this publication: merozoite surface protein 5, Duffy receptor precursor

Orthology

OrthoMCL

Part of OrthoMCL group OG4_48471

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PVX_003775 merozoite surface protein 4, putative
MKVAYFLSVLDLLIIFSLYFDGRRSAFAGIAACIRHGRILGEGGEQSGGASGGSSGGSSGDSSGGLSGGSSGGPSPPAGS
SGSGGSDPANSATGPQNSTPGSGGQTGDHSAEAENGDYNEQGDDHGDDHGDDHGDDHGDDHGDDHGDDHGDDHGDDHGDE
QDGEDYDDAEDDDLYELSEVDENANLCLDNNGGCGDDKICENLGKGIVKCLCKPGYKLVGTECVESSKSSSLNSFFCWFL
LVIIVLASIN

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_003775

General Sub-Cellular Localisation Links