ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

PVX_003770 (MSP5)

merozoite surface protein 5, a gene from Plasmodium vivax

Compiled localisation
apical and not surface during merozoite

Who localised this protein by microscopy?

Black, C. G., Barnwell, J. W., Huber, C. S., Galinski, M. R., Coppel, R. L.
The Plasmodium vivax homologues of merozoite surface proteins 4 and 5 from Plasmodium falciparum are expressed at different locations in the merozoite. (2002 Apr 9, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical and not surface during merozoite
  • "Surprisingly, the pattern of fluorescent reactivity with antisera to PvMSP5 was not consistent with the bunch of grapes surface rim pattern typically seen with antibodies to MSP1, MSP2, MSP3, MSP4, or that reported for P. falciparum MSP5. Instead, the pattern seen consistently with either rabbit (Fig. 4B and E) or mouse (not shown) PvMSP5 antisera was that of a localization exhibiting as a single large dot or spot of fluorescence at the apical end of the merozoite."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody
  • Strain: Plasmodium vivax (Belem
  • Gene model mapping comments: Blast from AF403476, annotation matches
  • Localisation record: apical and not surface during merozoite
  • Comment: strain information not found
  • Other genes localised in this publication: merozoite surface protein 4, putative, Duffy receptor precursor

Orthology

OrthoMCL

Part of OrthoMCL group OG4_57714

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>PVX_003770 merozoite surface protein 5
MAIARVVLAIHLFLLCSYHSGRPLEVSLWGQGNAHLGTQTSRLLRESGRNGQANRVNQADQADQVASPPISGKERRRGIG
MTSNLQLLSGEDEKDSTSEEAPNLEGKDNADAGKDGEKEPSEKQSGDVDPTVTDAERAKDENASVSEEEQMKTLDSGEDH
TDDGNADGGQGGGDGNDENQKGDGKEKEGGEEKKEDGKDDHEKGEKGSEGESGEKDEAAPKGDAAEKDKKLESKTADAKV
SEHKADDANPGGNKDSPEGESPKEGNPDDPSQKNPEAAGDDDSRLHLDNLDDKVPHYSALRNNRVEKGVTDTMVLNDIIG
ENAKSCSVDNGGCADDQICIRIDNIGIKCICKEGHLFGDKCILTKSSALGSFFSAGLFALLALLWLC

Proteomics

Found in:

Not found in:

Gene-Specific Links for PVX_003770

General Sub-Cellular Localisation Links